• Gene id: 26576

Gene Summary

• Gene Symbol: SRPK3   Gene   UCSC   Ensembl
• Aliases: MSSK-1, MSSK1, STK23
• Gene name: SRSF protein kinase 3
• Alternate names: SRSF protein kinase 3, SFRS protein kinase 3, SR-protein-specific kinase 3, muscle-specific serine kinase 1, serine arginine rich protein-specific kinase 3, serine/threonine kinase 23, serine/threonine-protein kinase 23, serine/threonine-protein kinase SRPK3,
• Gene location: Xq28 (153781000: 153785731)     Exons: 16     NC_000023.11
• Gene summary(Entrez): This gene encodes a protein kinase similar to a protein kinase which is specific for the SR (serine/arginine-rich domain) family of splicing factors. A highly similar protein has been shown to play a role in muscle development in mice. Multiple transcript
• OMIM: 602062

Protein Summary

• Protein general information: Q9UPE1  
  • Name: SRSF protein kinase 3 (EC 2.7.11.1) (Muscle specific serine kinase 1) (MSSK 1) (Serine/arginine rich protein specific kinase 3) (SR protein specific kinase 3) (Serine/threonine protein kinase 23)
  • Length: 567  
  • Mass: 62014
  • Tissue specificity: Exclusively expressed in skeletal and heart muscle. {ECO
• Sequence:

  MSASTGGGGDSGGSGGSSSSSQASCGPESSGSELALATPVPQMLQGLLGSDDEEQEDPKDYCKGGYHPVKIGDVF
  NGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDF
  RISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDA
  YIRRLAAEATEWQQAGAPPPSRSIVSTAPQEVLQTGKLSKNKRKKMRRKRKQQKRLLEERLRDLQRLEAMEAATQ
  AEDSGLRLDGGSGSTSSSGCHPGGARAGPSPASSSPAPGGGRSLSAGSQTSGFSGSLFSPASCSILSGSSNQRET
  GGLLSPSTPFGASNLLVNPLEPQNADKIKIKIADLGNACWVHKHFTEDIQTRQYRAVEVLIGAEYGPPADIWSTA
  CMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLM
  EKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCLQHPWLNP

• Structural information:
  • Protein Domains: (79..56-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • STRING: ENSP00000359119
• Other Databases: GeneCards:  SRPK3  Malacards:  SRPK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004707	MAP kinase activity	IBA	molecular function
GO:0050684	regulation of mRNA processing	IBA	biological process
GO:0000245	spliceosomal complex assembly	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0060537	muscle tissue development	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0007517	muscle organ development	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060537	muscle tissue development	IEA	biological process
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000165	MAPK cascade	IEA	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq