• Gene id: 26525

Gene Summary

• Gene Symbol: IL36RN   Gene   UCSC   Ensembl
• Aliases: FIL1, FIL1(DELTA), FIL1D, IL-36Ra, IL1F5, IL1HY1, IL1L1, IL1RP3, IL36RA, PSORP, PSORS14
• Gene name: interleukin 36 receptor antagonist
• Alternate names: interleukin-36 receptor antagonist protein, IL-1 related protein 3, IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta), IL-1ra homolog 1, IL1F5 (Canonical product IL-1F5a), interleukin 1 family, member 5 (delta), interleukin-1 HY1, interleukin-1 receptor ,
• Gene location: 2q14.1 (113058637: 113064743)     Exons: 13     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 famil
• OMIM: 605507

Protein Summary

• Protein general information: Q9UBH0  
  • Name: Interleukin 36 receptor antagonist protein (IL 36Ra) (FIL1 delta) (IL 1 related protein 3) (IL 1RP3) (Interleukin 1 HY1) (IL 1HY1) (Interleukin 1 delta) (IL 1 delta) (Interleukin 1 family member 5) (IL 1F5) (Interleukin 1 receptor antagonist homolog 1) (I
  • Length: 155  
  • Mass: 16962
  • Tissue specificity: Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin. {ECO
• Sequence:

  MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQE
  PTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFY
  FQQCD

• Structural information:
  • Interpro: IPR020877  IPR000975  IPR003297  IPR027171  IPR008996  
  • Prosite: PS00253
  • PDB: 4P0J 4P0K 4P0L
  • PDBsum: 4P0J 4P0K 4P0L
  • STRING: ENSP00000376896
• Other Databases: GeneCards:  IL36RN  Malacards:  IL36RN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006954	inflammatory response	IBA	biological process
GO:0002437	inflammatory response to antigenic stimulus	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:1902714	negative regulation of interferon-gamma secretion	IMP	biological process
GO:0019732	antifungal humoral response	IMP	biological process
GO:0001960	negative regulation of cytokine-mediated signaling pathway	IMP	biological process
GO:0032700	negative regulation of interleukin-17 production	IMP	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005149	interleukin-1 receptor binding	IEA	molecular function
GO:0005152	interleukin-1 receptor antagonist activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005152	interleukin-1 receptor antagonist activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032715	negative regulation of interleukin-6 production	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Psoriasis	KEGG:H01656
Psoriasis	KEGG:H01656
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881