• Gene id: 26523

Gene Summary

• Gene Symbol: AGO1   Gene   UCSC   Ensembl
• Aliases: EIF2C, EIF2C1, GERP95, Q99, hAgo1
• Gene name: argonaute RISC component 1
• Alternate names: protein argonaute-1, Golgi Endoplasmic Reticulum protein 95 kDa, argonaute 1, RISC catalytic component, argonaute RISC catalytic component 1, argonaute1, eIF-2C 1, eIF2C 1, eukaryotic translation initiation factor 2C, 1, putative RNA-binding protein Q99,
• Gene location: 1p34.3 (35869807: 35930531)     Exons: 20     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represse
• OMIM: 604988

Protein Summary

• Protein general information: Q9UL18  
  • Name: Protein argonaute 1 (Argonaute1) (hAgo1) (Argonaute RISC catalytic component 1) (Eukaryotic translation initiation factor 2C 1) (eIF 2C 1) (eIF2C 1) (Putative RNA binding protein Q99)
  • Length: 857  
  • Mass: 97214
• Sequence:

  MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIKPDKCPRRVNREVVEY
  MVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQI
  PVPLESVQALDVAMRHLASMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKA
  QPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLESGQ
  TVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQE
  EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGGRNRAIATPNQGVWDMRGKQFYNGIEIKVWA
  IACFAPQKQCREEVLKNFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTP
  VYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPP
  AGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKPTRIIFYRDGVPEGQLP
  QILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNERIGKSGNIPAGTTVDTNITHPFEFDFYLCS
  HAGIQGTSRPSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEG
  SHISGQSNGRDPQALAKAVQVHQDTLRTMYFA

• Structural information:
  • Protein Domains: (226..34-)
    (/note="PAZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00142-)
    (515..81-)
    (/note="Piwi-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00150"-)
  • Interpro: IPR014811  IPR032472  IPR032473  IPR032474  IPR003100   IPR036085  IPR003165  IPR012337  IPR036397  
  • Prosite: PS50821 PS50822
  • PDB: 1SI2 1SI3 4KRE 4KRF 4KXT 5W6V
  • PDBsum: 1SI2 1SI3 4KRE 4KRF 4KXT 5W6V
  • DIP: 29193
  • STRING: ENSP00000362300
• Other Databases: GeneCards:  AGO1  Malacards:  AGO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0004521	endoribonuclease activity	IDA	NOT|molecular function
GO:0016442	RISC complex	IDA	cellular component
GO:0005844	polysome	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0007223	Wnt signaling pathway, calcium modulating pathway	TAS	biological process
GO:0010629	negative regulation of gene expression	TAS	biological process
GO:0060964	regulation of gene silencing by miRNA	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010628	positive regulation of gene expression	TAS	biological process
GO:0035194	post-transcriptional gene silencing by RNA	TAS	biological process
GO:0045652	regulation of megakaryocyte differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035198	miRNA binding	IEA	molecular function
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0010586	miRNA metabolic process	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000932	P-body	IEA	cellular component
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0016442	RISC complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IMP	biological process
GO:0010501	RNA secondary structure unwinding	IMP	biological process
GO:0035198	miRNA binding	IDA	molecular function
GO:0003727	single-stranded RNA binding	IDA	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0000993	RNA polymerase II complex binding	IDA	molecular function
GO:0001046	core promoter sequence-specific DNA binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0035280	miRNA loading onto RISC involved in gene silencing by miRNA	IDA	biological process
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0090625	mRNA cleavage involved in gene silencing by siRNA	IDA	NOT|biological process
GO:0010501	RNA secondary structure unwinding	IDA	biological process
GO:0016442	RISC complex	IDA	cellular component
GO:0035279	mRNA cleavage involved in gene silencing by miRNA	IDA	NOT|biological process
GO:0016442	RISC complex	IDA	cellular component
GO:0005634	nucleus	IC	cellular component
GO:0016525	negative regulation of angiogenesis	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0000932	P-body	IEA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0000956	nuclear-transcribed mRNA catabolic process	IDA	biological process
GO:0035278	miRNA mediated inhibition of translation	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq