• Gene id: 26520

Gene Summary

• Gene Symbol: TIMM9   Gene   UCSC   Ensembl
• Aliases: TIM9, TIM9A
• Gene name: translocase of inner mitochondrial membrane 9
• Alternate names: mitochondrial import inner membrane translocase subunit Tim9, translocase of inner mitochondrial membrane 9 homolog,
• Gene location: 14q23.1 (58427613: 58408493)     Exons: 6     NC_000014.9
• Gene summary(Entrez): TIMM9 belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondri
• OMIM: 607384

Protein Summary

• Protein general information: Q9Y5J7  
  • Name: Mitochondrial import inner membrane translocase subunit Tim9
  • Length: 89  
  • Mass: 10378
  • Tissue specificity: Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle. {ECO
• Sequence:

  MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQN
  EALAAKAGLLGQPR

• Structural information:
  • Interpro: IPR004217  IPR035427  
  • PDB: 2BSK
  • PDBsum: 2BSK
  • STRING: ENSP00000378588
• Other Databases: GeneCards:  TIMM9  Malacards:  TIMM9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0008270	zinc ion binding	TAS	molecular function
GO:0007605	sensory perception of sound	TAS	biological process
GO:0006626	protein targeting to mitochondrion	TAS	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006626	protein targeting to mitochondrion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042719	mitochondrial intermembrane space protein transporter complex	IEA	cellular component
GO:0045039	protein insertion into mitochondrial inner membrane	IEA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0140318	protein transporter activity	IDA	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0042719	mitochondrial intermembrane space protein transporter complex	IDA	cellular component
GO:0042719	mitochondrial intermembrane space protein transporter complex	TAS	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0045039	protein insertion into mitochondrial inner membrane	IDA	biological process
GO:0072321	chaperone-mediated protein transport	IDA	biological process
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0045039	protein insertion into mitochondrial inner membrane	ISS	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq