• Gene id: 26519

Gene Summary

• Gene Symbol: TIMM10   Gene   UCSC   Ensembl
• Aliases: TIM10, TIM10A, TIMM10A
• Gene name: translocase of inner mitochondrial membrane 10
• Alternate names: mitochondrial import inner membrane translocase subunit Tim10, translocase of inner mitochondrial membrane 10 homolog,
• Gene location: 11q12.1 (57542504: 57528463)     Exons: 4     NC_000011.10
• Gene summary(Entrez): The mitochondrial protein encoded by this gene belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophob
• OMIM: 615499

Protein Summary

• Protein general information: P62072  
  • Name: Mitochondrial import inner membrane translocase subunit Tim10
  • Length: 90  
  • Mass: 10333
  • Tissue specificity: Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle. {ECO
• Sequence:

  MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQ
  DEELMKRVQQSSGPA

• Structural information:
  • Interpro: IPR027100  IPR004217  IPR035427  
  • PDB: 2BSK
  • PDBsum: 2BSK
  • STRING: ENSP00000257245
• Other Databases: GeneCards:  TIMM10  Malacards:  TIMM10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045039	protein insertion into mitochondrial inner membrane	IBA	biological process
GO:0005743	mitochondrial inner membrane	IBA	cellular component
GO:0042719	mitochondrial intermembrane space protein transporter complex	IEA	cellular component
GO:0045039	protein insertion into mitochondrial inner membrane	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006626	protein targeting to mitochondrion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042719	mitochondrial intermembrane space protein transporter complex	IEA	cellular component
GO:0045039	protein insertion into mitochondrial inner membrane	IEA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0140318	protein transporter activity	IDA	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0042719	mitochondrial intermembrane space protein transporter complex	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0045039	protein insertion into mitochondrial inner membrane	IDA	biological process
GO:0072321	chaperone-mediated protein transport	IDA	biological process
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0045039	protein insertion into mitochondrial inner membrane	ISS	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0007605	sensory perception of sound	TAS	biological process
GO:0008270	zinc ion binding	TAS	molecular function
GO:0006626	protein targeting to mitochondrion	TAS	biological process
GO:0005744	TIM23 mitochondrial import inner membrane translocase complex	TAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881