• Gene id: 26515

Gene Summary

• Gene Symbol: TIMM10B   Gene   UCSC   Ensembl
• Aliases: FXC1, TIM10B, Tim9b
• Gene name: translocase of inner mitochondrial membrane 10B
• Alternate names: mitochondrial import inner membrane translocase subunit Tim10 B, fracture callus 1 homolog, fracture callus protein 1, mitochondrial import inner membrane translocase subunit Tim9 B, translocase of inner mitochondrial membrane 10 homolog B,
• Gene location: 11p15.4 (6481500: 6484680)     Exons: 3     NC_000011.10
• Gene summary(Entrez): FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the
• OMIM: 0

Protein Summary

• Protein general information: Q9Y5J6  
  • Name: Mitochondrial import inner membrane translocase subunit Tim10 B (Fracture callus protein 1) (FxC1) (Mitochondrial import inner membrane translocase subunit Tim9 B) (TIMM10B) (Tim10b)
  • Length: 103  
  • Mass: 11586
  • Tissue specificity: Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle. {ECO
• Sequence:

  MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALV
  QRRIADYEAASAVPGVAAEQPGVSPSGS

• Structural information:
  • Interpro: IPR004217  IPR035427  
  • STRING: ENSP00000254616
• Other Databases: GeneCards:  TIMM10B  Malacards:  TIMM10B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042719	mitochondrial intermembrane space protein transporter complex	IBA	cellular component
GO:0042721	TIM22 mitochondrial import inner membrane insertion complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0007160	cell-matrix adhesion	TAS	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006626	protein targeting to mitochondrion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042719	mitochondrial intermembrane space protein transporter complex	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881