• Gene id: 26499

Gene Summary

• Gene Symbol: PLEK2   Gene   UCSC   Ensembl
• Gene name: pleckstrin 2
• Alternate names: pleckstrin-2, pleckstrin 2 homolog,
• Gene location: 14q23.3-q24.1 (67412164: 67386983)     Exons: 9     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene associates with membrane-bound phosphatidylinositols generated by phosphatidylinositol 3-kinase. The encoded protein then interacts with the actin cytoskeleton to induce cell spreading. In conjunction with complement compo
• OMIM: 608007

Protein Summary

• Protein general information: Q9NYT0  
  • Name: Pleckstrin 2
  • Length: 353  
  • Mass: 39971
• Sequence:

  MEDGVLKEGFLVKRGHIVHNWKARWFILRQNTLVYYKLEGGRRVTPPKGRILLDGCTITCPCLEYENRPLLIKLK
  TQTSTEYFLEACSREERDAWAFEITGAIHAGQPGKVQQLHSLRNSFKLPPHISLHRIVDKMHDSNTGIRSSPNME
  QGSTYKKTFLGSSLVDWLISNSFTASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAE
  SYKKKISPKEEISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSL
  VSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT

• Structural information:
  • Protein Domains: (4..10-)
    (/note="PH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (139..22-)
    (/note="DEP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00066-)
    (247..35-)
    (/note="PH-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR000591  IPR011993  IPR001849  IPR037370  IPR037369   IPR036388  IPR036390  
  • Prosite: PS50186 PS50003
  • CDD: cd04444
  • PDB: 1X1G
  • PDBsum: 1X1G
  • STRING: ENSP00000216446
• Other Databases: GeneCards:  PLEK2  Malacards:  PLEK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031532	actin cytoskeleton reorganization	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0080025	phosphatidylinositol-3,5-bisphosphate binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031346	positive regulation of cell projection organization	IEA	biological process
GO:0031532	actin cytoskeleton reorganization	IEA	biological process
GO:0032266	phosphatidylinositol-3-phosphate binding	IEA	molecular function
GO:0043325	phosphatidylinositol-3,4-bisphosphate binding	IEA	molecular function
GO:0120034	positive regulation of plasma membrane bounded cell projection assembly	IEA	biological process
GO:0031258	lamellipodium membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray