• Gene id: 2648

Gene Summary

• Gene Symbol: KAT2A   Gene   UCSC   Ensembl
• Aliases: GCN5, GCN5L2, PCAF-b, hGCN5
• Gene name: lysine acetyltransferase 2A
• Alternate names: histone acetyltransferase KAT2A, GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2, General control of amino acid synthesis, yeast, homolog-like 2, K(lysine) acetyltransferase 2A, STAF97, general control of amino acid synthesis protein 5-li,
• Gene location: 17q21.2 (42121366: 42113110)     Exons: 18     NC_000017.11
• Gene summary(Entrez): KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-
• OMIM: 300965

Protein Summary

• Protein general information: Q92830  
  • Name: Histone acetyltransferase KAT2A (EC 2.3.1.48) (General control of amino acid synthesis protein 5 like 2) (Histone acetyltransferase GCN5) (hGCN5) (Histone glutaryltransferase KAT2A) (EC 2.3.1. ) (Histone succinyltransferase KAT2A) (EC 2.3.1. ) (Lysine ace
  • Length: 837  
  • Mass: 93926
  • Tissue specificity: Expressed in all tissues tested, with most abundant expression in ovary.
• Sequence:

  MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGAGSGGD
  PARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSC
  EHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPP
  FEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
  VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIW
  ESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRV
  MGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQN
  VFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE
  YHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEII
  KKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSA
  WPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFF
  YFKLKEGGLIDK

• Structural information:
  • Protein Domains: (503..65-)
    (/note="N-acetyltransferase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00532-)
    (745..81-)
    (/note="Bromo-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00035"-)
  • Interpro: IPR016181  IPR001487  IPR036427  IPR018359  IPR037800   IPR016376  IPR000182  IPR009464  
  • Prosite: PS00633 PS50014 PS51186
  • PDB: 1F68 1Z4R 3D7C 5H84 5H86 5MLJ 5TRL 5TRM 6J3P
  • PDBsum: 1F68 1Z4R 3D7C 5H84 5H86 5MLJ 5TRL 5TRM 6J3P
  • DIP: 28146
  • STRING: ENSP00000225916
• Other Databases: GeneCards:  KAT2A  Malacards:  KAT2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IDA	molecular function
GO:0106078	histone succinyltransferase activity	IDA	molecular function
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0018393	internal peptidyl-lysine acetylation	IDA	biological process
GO:0018393	internal peptidyl-lysine acetylation	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0045252	oxoglutarate dehydrogenase complex	IDA	colocalizes with
GO:0005634	nucleus	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0106077	histone succinylation	IDA	biological process
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0046600	negative regulation of centriole replication	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0061733	peptide-lysine-N-acetyltransferase activity	IDA	molecular function
GO:0061733	peptide-lysine-N-acetyltransferase activity	IDA	molecular function
GO:0000123	histone acetyltransferase complex	IDA	cellular component
GO:0016573	histone acetylation	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0000123	histone acetyltransferase complex	IDA	cellular component
GO:0016573	histone acetylation	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0106227	peptidyl-lysine glutarylation	IDA	biological process
GO:0106229	histone glutaryltransferase activity	IDA	molecular function
GO:0050863	regulation of T cell activation	ISS	biological process
GO:0048167	regulation of synaptic plasticity	ISS	biological process
GO:0045589	regulation of regulatory T cell differentiation	ISS	biological process
GO:0007616	long-term memory	ISS	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060173	limb development	ISS	biological process
GO:0007507	heart development	ISS	biological process
GO:0001816	cytokine production	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000036	regulation of stem cell population maintenance	ISS	biological process
GO:1903010	regulation of bone development	ISS	biological process
GO:0061035	regulation of cartilage development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0008080	N-acetyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0016573	histone acetylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0006338	chromatin remodeling	TAS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0031647	regulation of protein stability	IMP	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0004402	histone acetyltransferase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0045815	positive regulation of gene expression, epigenetic	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000727	positive regulation of cardiac muscle cell differentiation	IEA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:0071929	alpha-tubulin acetylation	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0050863	regulation of T cell activation	IEA	biological process
GO:0048167	regulation of synaptic plasticity	IEA	biological process
GO:0045722	positive regulation of gluconeogenesis	IEA	biological process
GO:0045589	regulation of regulatory T cell differentiation	IEA	biological process
GO:0043983	histone H4-K12 acetylation	IEA	biological process
GO:0022037	metencephalon development	IEA	biological process
GO:0021537	telencephalon development	IEA	biological process
GO:0016407	acetyltransferase activity	IEA	molecular function
GO:0008080	N-acetyltransferase activity	IEA	molecular function
GO:0007616	long-term memory	IEA	biological process
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IEA	cellular component
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0048312	intracellular distribution of mitochondria	IEA	biological process
GO:0035066	positive regulation of histone acetylation	IEA	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0031346	positive regulation of cell projection organization	IEA	biological process
GO:0019903	protein phosphatase binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000790	nuclear chromatin	IEA	cellular component
GO:2000036	regulation of stem cell population maintenance	IEA	biological process
GO:1903010	regulation of bone development	IEA	biological process
GO:0072686	mitotic spindle	IEA	cellular component
GO:0061035	regulation of cartilage development	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0044154	histone H3-K14 acetylation	IEA	biological process
GO:0043997	histone acetyltransferase activity (H4-K12 specific)	IEA	molecular function
GO:0043966	histone H3 acetylation	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0030914	STAGA complex	IEA	cellular component
GO:0030901	midbrain development	IEA	biological process
GO:0010484	H3 histone acetyltransferase activity	IEA	molecular function
GO:0008283	cell population proliferation	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0001843	neural tube closure	IEA	biological process
GO:0001816	cytokine production	IEA	biological process
GO:0001756	somitogenesis	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0000123	histone acetyltransferase complex	IEA	cellular component
GO:0010484	H3 histone acetyltransferase activity	IDA	molecular function
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IDA	cellular component
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0030914	STAGA complex	IDA	cellular component
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0016578	histone deubiquitination	IDA	biological process
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0005615	extracellular space	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa05203	Viral carcinogenesis
hsa04919	Thyroid hormone signaling pathway
hsa04330	Notch signaling pathway

Diseases

Associated diseases	References
lung non-small cell carcinoma	PMID:23543735
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq