• Gene id: 26469

Gene Summary

• Gene Symbol: PTPN18   Gene   UCSC   Ensembl
• Aliases: BDP1, PTP-HSCF
• Gene name: protein tyrosine phosphatase non-receptor type 18
• Alternate names: tyrosine-protein phosphatase non-receptor type 18, brain-derived phosphatase, protein tyrosine phosphatase, non-receptor type 18 (brain-derived),
• Gene location: 2q21.1 (130356011: 130375404)     Exons: 16     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, the mitotic cycle, and oncogenic
• OMIM: 190920

Protein Summary

• Protein general information: Q99952  
  • Name: Tyrosine protein phosphatase non receptor type 18 (EC 3.1.3.48) (Brain derived phosphatase)
  • Length: 460  
  • Mass: 50482
  • Tissue specificity: Expressed in brain, colon and several tumor-derived cell lines. {ECO
• Sequence:

  MSRSLDSARSFLERLEARGGREGAVLAGEFSDIQACSAAWKADGVCSTVAGSRPENVRKNRYKDVLPYDQTRVIL
  SLLQEEGHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFWRLVWEFGVKVILMACREIENGRKRCERYWAQEQE
  PLQTGLFCITLIKEKWLNEDIMLRTLKVTFQKESRSVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPL
  CVHCSAGCGRTGVLCTVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNAS
  PHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAMADTYAVVQKRGAPAGAGSGTQTGTG
  TGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPKGP
  RDPPAEWTRV

• Structural information:
  • Protein Domains: (26..29-)
    (/note="Tyrosine-protein-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00160"-)
  • Interpro: IPR029021  IPR000242  IPR016130  IPR003595  IPR000387  
  • Prosite: PS00383 PS50056 PS50055
  • PDB: 2OC3 4GFU 4GFV 4NND
  • PDBsum: 2OC3 4GFU 4GFV 4NND
  • STRING: ENSP00000175756
• Other Databases: GeneCards:  PTPN18  Malacards:  PTPN18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035335	peptidyl-tyrosine dephosphorylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004726	non-membrane spanning protein tyrosine phosphatase activity	IBA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004726	non-membrane spanning protein tyrosine phosphatase activity	TAS	molecular function
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	EXP	molecular function
GO:0071345	cellular response to cytokine stimulus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038128	ERBB2 signaling pathway	TAS	biological process
GO:1901185	negative regulation of ERBB signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001825	blastocyst formation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004726	non-membrane spanning protein tyrosine phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq