• Gene id: 2642

Gene Summary

• Gene Symbol: GCGR   Gene   UCSC   Ensembl
• Aliases: GGR, GL-R
• Gene name: glucagon receptor
• Alternate names: glucagon receptor,
• Gene location: 17q25.3 (81804077: 81814007)     Exons: 6     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a glucagon receptor that is important in controlling blood glucose levels. Defects in this gene are a cause of non-insulin-dependent diabetes mellitus (NIDDM).[provided by RefSeq, Jan 2010]
• OMIM: 138033

Protein Summary

• Protein general information: P47871  
  • Name: Glucagon receptor (GL R)
  • Length: 477  
  • Mass: 54009
• Sequence:

  MPPCQPQRPLLLLLLLLACQPQVPSAQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANT
  TANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQVMYTVGYS
  LSLGALLLALAILGGLSKLHCTRNAIHANLFASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSTWLSDGAVAGCR
  VAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDN
  MGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGVHEVVFAFVTDEHAQG
  TLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRLGKVLWEERNTSNHRASSSPGHGPPSKELQF
  GRGGGSQDSSAETPLAGGLPRLAESPF

• Structural information:
  • Interpro: IPR017981  IPR036445  IPR001879  IPR003290  IPR003291   IPR000832  IPR017983  
  • Prosite: PS00649 PS00650 PS50227 PS50261
  • PDB: 2A83 3CZF 4ERS 4L6R 4LF3 5EE7 5XEZ
  • PDBsum: 2A83 3CZF 4ERS 4L6R 4LF3 5EE7 5XEZ
  • STRING: ENSP00000383558
• Other Databases: GeneCards:  GCGR  Malacards:  GCGR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009267	cellular response to starvation	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0017046	peptide hormone binding	IBA	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004967	glucagon receptor activity	IBA	molecular function
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0004967	glucagon receptor activity	IDA	molecular function
GO:0071377	cellular response to glucagon stimulus	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0004967	glucagon receptor activity	IDA	molecular function
GO:0042594	response to starvation	ISS	biological process
GO:0042593	glucose homeostasis	ISS	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IMP	biological process
GO:0070873	regulation of glycogen metabolic process	ISS	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0004967	glucagon receptor activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004967	glucagon receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0006091	generation of precursor metabolites and energy	TAS	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007584	response to nutrient	TAS	biological process
GO:0008217	regulation of blood pressure	TAS	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0071377	cellular response to glucagon stimulus	TAS	biological process
GO:0017046	peptide hormone binding	IEA	molecular function
GO:0009755	hormone-mediated signaling pathway	IEA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0004967	glucagon receptor activity	IEA	molecular function
GO:0042594	response to starvation	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004967	glucagon receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0006887	exocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0071377	cellular response to glucagon stimulus	IEA	biological process
GO:0070873	regulation of glycogen metabolic process	IEA	biological process
GO:0009267	cellular response to starvation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04922	Glucagon signaling pathway

Diseases

Associated diseases	References
type 2 diabetes mellitus	PMID:7773293
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq