• Gene id: 26355

Gene Summary

• Gene Symbol: FAM162A   Gene   UCSC   Ensembl
• Aliases: C3orf28, E2IG5, HGTD-P
• Gene name: family with sequence similarity 162 member A
• Alternate names: protein FAM162A, E2-induced gene 5 protein, HIF-1 alpha-responsive proapoptotic molecule, growth and transformation-dependent protein,
• Gene location: 3q21.1 (122384181: 122412333)     Exons: 20     NC_000003.12
• OMIM: 608017

Protein Summary

• Protein general information: Q96A26  
  • Name: Protein FAM162A (E2 induced gene 5 protein) (Growth and transformation dependent protein) (HGTD P)
  • Length: 154  
  • Mass: 17342
• Sequence:

  MGSLSGLRLAAGSCFRLCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSG
  RFKKEDEIPETVSLEMLDAAKNKMRVKISYLMIALTVVGCIFMVIEGKKAAQRHETLTSLNLEKKARLKEEAAMK
  AKTE

• Structural information:
  • Interpro: IPR009432  
  • STRING: ENSP00000419088
• Other Databases: GeneCards:  FAM162A  Malacards:  FAM162A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071456	cellular response to hypoxia	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0051402	neuron apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881