• Gene id: 26354

Gene Summary

• Gene Symbol: GNL3   Gene   UCSC   Ensembl
• Aliases: C77032, E2IG3, NNP47, NS
• Gene name: G protein nucleolar 3
• Alternate names: guanine nucleotide-binding protein-like 3, E2-induced gene 3 protein, estradiol-induced nucleotide binding protein, guanine nucleotide binding protein-like 3 (nucleolar), novel nucleolar protein 47, nucleolar GTP-binding protein 3, nucleostemin,
• Gene location: 3p21.1 (52685919: 52694496)     Exons: 15     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene may interact with p53 and may be involved in tumorigenesis. The encoded protein also appears to be important for stem cell proliferation. This protein is found in both the nucleus and nucleolus. Three transcript variants e
• OMIM: 608011

Protein Summary

• Protein general information: Q9BVP2  
  • Name: Guanine nucleotide binding protein like 3 (E2 induced gene 3 protein) (Novel nucleolar protein 47) (NNP47) (Nucleolar GTP binding protein 3) (Nucleostemin)
  • Length: 549  
  • Mass: 61993
  • Tissue specificity: Increased levels in lung tissue in cancer patients. {ECO
• Sequence:

  MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLREAELRKQRLEELK
  QQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLEVLDA
  RDPLGCRCPQVEEAIVQSGQKKLVLILNKSDLVPKENLESWLNYLKKELPTVVFRASTKPKDKGKITKRVKAKKN
  AAPFRSEVCFGKEGLWKLLGGFQETCSKAIRVGVIGFPNVGKSSIINSLKQEQMCNVGVSMGLTRSMQVVPLDKQ
  ITIIDSPSFIVSPLNSSSALALRSPASIEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTVLAQRRGMH
  QKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGFNLEELEKNNAQSIRAIKGPHLAN
  SILFQSSGLTNGIIEEKDIHEELPKRKERKQEEREDDKDSDQETVDEEVDENSSGMFAAEETGEALSEETTAGEQ
  STRSFILDKIIEEDDAYDFSTDYV

• Structural information:
  • Protein Domains: (131..31-)
    (/note="CP-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01058"-)
  • Interpro: IPR030378  IPR014813  IPR006073  IPR027417  
  • Prosite: PS51721
  • STRING: ENSP00000395772
• Other Databases: GeneCards:  GNL3  Malacards:  GNL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IBA	cellular component
GO:0017145	stem cell division	IDA	biological process
GO:0019827	stem cell population maintenance	IMP	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0008283	cell population proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0032206	positive regulation of telomere maintenance	IMP	biological process
GO:0033235	positive regulation of protein sumoylation	IMP	biological process
GO:1904816	positive regulation of protein localization to chromosome, telomeric region	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IMP	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0042127	regulation of cell population proliferation	ISS	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0005730	nucleolus	ISS	cellular component
GO:0005525	GTP binding	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881