• Gene id: 2635

Gene Summary

• Gene Symbol: GBP3   Gene   UCSC   Ensembl
• Gene name: guanylate binding protein 3
• Alternate names: guanylate-binding protein 3, GTP-binding protein 3, guanine nucleotide-binding protein 3, guanylate-binding protein 3 delta C,
• Gene location: 1p22.2 (89022869: 89006676)     Exons: 12     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the guanylate-binding protein (GBP) family. GBPs specifically bind guanine nucleotides (GMP, GDP, and GTP) and contain two of the three consensus motifs found in typical GTP-binding proteins. The encoded protein interacts wit
• OMIM: 603433

Protein Summary

• Protein general information: Q9H0R5  
  • Name: Guanylate binding protein 3 (EC 3.6.5. ) (GTP binding protein 3) (GBP 3) (Guanine nucleotide binding protein 3)
  • Length: 595  
  • Mass: 68114
• Sequence:

  MAPEIHMTGPMCLIENTNGELVANPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKNKGFSLGSTVKSHT
  KGIWMWCVPHPKKPEHTLVLLDTEGLGDVKKGDNQNDSWIFTLAVLLSSTLVYNSMGTINQQAMDQLYYVTELTH
  RIRSKSSPDENENEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLEYSLKLTQGTSQKDKNFNLPRLCIR
  KFFPKKKCFVFDLPIHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIKVNGPRLESLVLTYIN
  AISRGDLPCMENAVLALAQIENSAAVQKAIAHYDQQMGQKVQLPAETLQELLDLHRVSEREATEVYMKNSFKDVD
  HLFQKKLAAQLDKKRDDFCKQNQEASSDRCSALLQVIFSPLEEEVKAGIYSKPGGYCLFIQKLQDLEKKYYEEPR
  KGIQAEEILQTYLKSKESVTDAILQTDQILTEKEKEIEVECVKAESAQASAKMVEEMQIKYQQMMEEKEKSYQEH
  VKQLTEKMERERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI

• Structural information:
  • Protein Domains: (35..27-)
    (/note="GB1/RHD3-type-G")
  • Interpro: IPR030386  IPR037684  IPR003191  IPR036543  IPR015894   IPR027417  
  • Prosite: PS51715
  • CDD: cd16269
  • STRING: ENSP00000359512
• Other Databases: GeneCards:  GBP3  Malacards:  GBP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0005525	GTP binding	IBA	molecular function
GO:0003924	GTPase activity	IBA	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0071356	cellular response to tumor necrosis factor	IEP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071347	cellular response to interleukin-1	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R