• Gene id: 2634

Gene Summary

• Gene Symbol: GBP2   Gene   UCSC   Ensembl
• Gene name: guanylate binding protein 2
• Alternate names: guanylate-binding protein 2, GTP-binding protein 2, guanine nucleotide-binding protein 2, guanylate binding protein 2, interferon-inducible, interferon-induced guanylate-binding protein 2,
• Gene location: 1p22.2 (89126113: 89106131)     Exons: 1     NC_000001.11
• Gene summary(Entrez): This gene belongs to the guanine-binding protein (GBP) family, which includes interferon-induced proteins that can bind to guanine nucleotides (GMP, GDP and GTP). The encoded protein is a GTPase which hydrolyzes GTP, predominantly to GDP. The protein may
• OMIM: 600412

Protein Summary

• Protein general information: P32456  
  • Name: Guanylate binding protein 2 (EC 3.6.5. ) (GTP binding protein 2) (GBP 2) (HuGBP 2) (Guanine nucleotide binding protein 2) (Interferon induced guanylate binding protein 2)
  • Length: 591  
  • Mass: 67209
• Sequence:

  MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKKNGFSLGSTVKSHT
  KGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMDQLHYVTELTD
  RIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGTDKKSKSFNDPRLCIR
  KFFPKRKCFVFDWPAPKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTLSGGIPVNGPRLESLVLTYVN
  AISSGDLPCMENAVLALAQIENSAAVEKAIAHYEQQMGQKVQLPTETLQELLDLHRDSEREAIEVFMKNSFKDVD
  QMFQRKLGAQLEARRDDFCKQNSKASSDCCMALLQDIFGPLEEDVKQGTFSKPGGYRLFTQKLQELKNKYYQVPR
  KGIQAKEVLKKYLESKEDVADALLQTDQSLSEKEKAIEVERIKAESAEAAKKMLEEIQKKNEEMMEQKEKSYQEH
  VKQLTEKMERDRAQLMAEQEKTLALKLQEQERLLKEGFENESKRLQKDIWDIQMRSKSLEPICNIL

• Structural information:
  • Protein Domains: (35..27-)
    (/note="GB1/RHD3-type-G")
  • Interpro: IPR030386  IPR037684  IPR003191  IPR036543  IPR015894   IPR027417  
  • Prosite: PS51715
  • CDD: cd16269
  • STRING: ENSP00000359497
• Other Databases: GeneCards:  GBP2  Malacards:  GBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0042832	defense response to protozoan	IBA	biological process
GO:0050830	defense response to Gram-positive bacterium	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0020005	symbiont-containing vacuole membrane	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005525	GTP binding	TAS	molecular function
GO:0006955	immune response	TAS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0034504	protein localization to nucleus	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0071356	cellular response to tumor necrosis factor	IEP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071347	cellular response to interleukin-1	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)