• Gene id: 2633

Gene Summary

• Gene Symbol: GBP1   Gene   UCSC   Ensembl
• Gene name: guanylate binding protein 1
• Alternate names: guanylate-binding protein 1, GBP-1, GTP-binding protein 1, guanine nucleotide-binding protein 1, guanylate binding protein 1, interferon-inducible, 67kDa, huGBP-1, interferon-induced guanylate-binding protein 1,
• Gene location: 1p22.2 (89065207: 89052318)     Exons: 11     NC_000001.11
• Gene summary(Entrez): Guanylate binding protein expression is induced by interferon. Guanylate binding proteins are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP) and are distinguished from the GTP-binding proteins by the presence o
• OMIM: 600411

Protein Summary

• Protein general information: P32455  
  • Name: Guanylate binding protein 1 (EC 3.6.5. ) (GTP binding protein 1) (GBP 1) (HuGBP 1) (Guanine nucleotide binding protein 1) (Interferon induced guanylate binding protein 1)
  • Length: 592  
  • Mass: 67931
• Sequence:

  MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHT
  KGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTH
  RIRSKSSPDENENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLC
  IRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTY
  VNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTETLQELLDLHRDSEREAIEVFIRSSFKD
  VDHLFQKELAAQLEKKRDDFCKQNQEASSDRCSALLQVIFSPLEEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEE
  PRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQASAKMLQEMQRKNEQMMEQKERSYQ
  EHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKACTIS

• Structural information:
  • Protein Domains: (35..27-)
    (/note="GB1/RHD3-type-G")
  • Interpro: IPR030386  IPR037684  IPR003191  IPR036543  IPR015894   IPR027417  
  • Prosite: PS51715
  • CDD: cd16269
  • PDB: 1DG3 1F5N 2B8W 2B92 2BC9 2D4H 6K1Z 6K2D
  • PDBsum: 1DG3 1F5N 2B8W 2B92 2BC9 2D4H 6K1Z 6K2D
  • DIP: 60423
  • STRING: ENSP00000359504
• Other Databases: GeneCards:  GBP1  Malacards:  GBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0005525	GTP binding	IBA	molecular function
GO:0003924	GTPase activity	IBA	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005525	GTP binding	TAS	molecular function
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0019003	GDP binding	IDA	molecular function
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0072665	protein localization to vacuole	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0003779	actin binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0012506	vesicle membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0071356	cellular response to tumor necrosis factor	IEP	biological process
GO:0030507	spectrin binding	IPI	molecular function
GO:0071347	cellular response to interleukin-1	IEP	biological process
GO:0050848	regulation of calcium-mediated signaling	IMP	biological process
GO:0051879	Hsp90 protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903077	negative regulation of protein localization to plasma membrane	IMP	biological process
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IMP	biological process
GO:0019955	cytokine binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050860	negative regulation of T cell receptor signaling pathway	IMP	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:1903076	regulation of protein localization to plasma membrane	IGI	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900041	negative regulation of interleukin-2 secretion	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R