• Gene id: 26292

Gene Summary

• Gene Symbol: MYCBP   Gene   UCSC   Ensembl
• Aliases: AMY-1
• Gene name: MYC binding protein
• Alternate names: C-Myc-binding protein, associate of myc-1, c-myc binding protein,
• Gene location: 1p34.3 (38873377: 38862489)     Exons: 10     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene binds to the N-terminus of the oncogenic protein C-MYC, enhancing the ability of C-MYC to activate E box-dependent transcription. The encoded protein is normally found in the cytoplasm, but it translocates to the nucleus d
• OMIM: 606535

Protein Summary

• Protein general information: Q99417  
  • Name: c Myc binding protein (Associate of Myc 1) (AMY 1)
  • Length: 103  
  • Mass: 11967
  • Tissue specificity: Highly expressed in heart, placenta, pancreas, skeletal muscle and kidney. Also present at low levels in lung.
• Sequence:

  MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEK
  YEAIVEENKKLKAKLAQYEPPQEEKRAE

• Structural information:
  • Interpro: IPR026060  
  • PDB: 2YY0
  • PDBsum: 2YY0
  • STRING: ENSP00000380702
• Other Databases: GeneCards:  MYCBP  Malacards:  MYCBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007283	spermatogenesis	IEP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)