• Gene id: 26291

Gene Summary

• Gene Symbol: FGF21   Gene   UCSC   Ensembl
• Gene name: fibroblast growth factor 21
• Alternate names: fibroblast growth factor 21,
• Gene location: 19q13.33 (48755523: 48758329)     Exons: 4     NC_000019.10
• Gene summary(Entrez): Theis gene encodes a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that funct
• OMIM: 605320

Protein Summary

• Protein general information: Q9NSA1  
  • Name: Fibroblast growth factor 21 (FGF 21)
  • Length: 209  
  • Mass: 22300
• Sequence:

  MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQ
  SPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNK
  SPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

• Structural information:
  • Interpro: IPR035444  IPR028292  IPR002209  IPR008996  
  • Prosite: PS00247
  • CDD: cd00058
  • PDB: 5VAQ
  • PDBsum: 5VAQ
  • STRING: ENSP00000471477
• Other Databases: GeneCards:  FGF21  Malacards:  FGF21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005104	fibroblast growth factor receptor binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:0071404	cellular response to low-density lipoprotein particle stimulus	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0035690	cellular response to drug	IEA	biological process
GO:0030968	endoplasmic reticulum unfolded protein response	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0090080	positive regulation of MAPKKK cascade by fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IEA	biological process
GO:1904640	response to methionine	IEA	biological process
GO:0072577	endothelial cell apoptotic process	IEA	biological process
GO:0071377	cellular response to glucagon stimulus	IEA	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0010898	positive regulation of triglyceride catabolic process	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0010988	regulation of low-density lipoprotein particle clearance	NAS	biological process
GO:0045716	positive regulation of low-density lipoprotein particle receptor biosynthetic process	NAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0046326	positive regulation of glucose import	IDA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04714	Thermogenesis
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05226	Gastric cancer
hsa05224	Breast cancer
hsa05218	Melanoma

Diseases

Associated diseases	References
Atherosclerosis	PMID:26047614
Chronic kidney disease	PMID:22494291
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881