• Gene id: 26284

Gene Summary

• Gene Symbol: ERAL1   Gene   UCSC   Ensembl
• Aliases: CEGA, ERA, ERA-W, ERAL1A, ERAL1B, H-ERA, HERA-A, HERA-B, PRLTS6
• Gene name: Era like 12S mitochondrial rRNA chaperone 1
• Alternate names: GTPase Era, mitochondrial, ERA-like protein 1, Era G-protein-like 1, GTP-binding protein era homolog, GTPase, human homolog of E. coli essential cell cycle protein Era, conserved ERA-like GTPase, era (E. coli G-protein homolog)-like 1,
• Gene location: 17q11.2 (74748627: 74769352)     Exons: 6     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a GTPase that localizes to the mitochondrion. The encoded protein binds to the 3' terminal stem loop of 12S mitochondrial rRNA and is required for proper assembly of the 28S small mitochondrial ribosomal subunit. Deleti
• OMIM: 607435

Protein Summary

• Protein general information: O75616  
  • Name: GTPase Era, mitochondrial (H ERA) (hERA) (Conserved ERA like GTPase) (CEGA) (ERA W) (ERA like protein 1)
  • Length: 437  
  • Mass: 48350
• Sequence:

  MAAPSWRGARLVQSVLRVWQVGPHVARERVIPFSSLLGFQRRCVSCVAGSAFSGPRLASASRSNGQGSALDHFLG
  FSQPDSSVTPCVPAVSMNRDEQDVLLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSRKVHTTRC
  QALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSMESADLVVVLVDVSDKWTRNQLSPQLLRCLTK
  YSQIPSVLVMNKVDCLKQKSVLLELTAALTEGVVNGKKLKMRQAFHSHPGTHCPSPAVKDPNTQSVGNPQRIGWP
  HFKEIFMLSALSQEDVKTLKQYLLTQAQPGPWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQKTAVW
  EEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLMDIFLCDVDIRLSVKLLK

• Structural information:
  • Protein Domains: (112..33-)
    (/note="Era-type-G)
    (360..43-)
    (/note="KH-type-2")
  • Interpro: IPR030388  IPR005662  IPR006073  IPR015946  IPR009019   IPR027417  IPR005225  
  • Prosite: PS51713
  • CDD: cd04163
  • STRING: ENSP00000254928
• Other Databases: GeneCards:  ERAL1  Malacards:  ERAL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043024	ribosomal small subunit binding	IBA	molecular function
GO:0005759	mitochondrial matrix	IBA	cellular component
GO:0000028	ribosomal small subunit assembly	IBA	biological process
GO:0019843	rRNA binding	IBA	molecular function
GO:0019843	rRNA binding	IDA	molecular function
GO:0043024	ribosomal small subunit binding	IDA	molecular function
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0000028	ribosomal small subunit assembly	IMP	biological process
GO:0000028	ribosomal small subunit assembly	IMP	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0019843	rRNA binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Perrault syndrome	KEGG:H02095
Perrault syndrome	KEGG:H02095
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881