• Gene id: 26279

Gene Summary

• Gene Symbol: PLA2G2D   Gene   UCSC   Ensembl
• Aliases: PLA2IID, SPLASH, sPLA2-IID, sPLA2S
• Gene name: phospholipase A2 group IID
• Alternate names: group IID secretory phospholipase A2, GIID sPLA2, phosphatidylcholine 2-acylhydrolase 2D, secretory phospholipase A2s, secretory-type PLA, stroma-associated homolog,
• Gene location: 1p36.12 (20119565: 20111938)     Exons: 4     NC_000001.11
• Gene summary(Entrez): This gene encodes a secreted member of the phospholipase A2 family, and is found in a cluster of related family members on chromosome 1. Phospholipase A2 family members hydrolyze the sn-2 fatty acid ester bond of glycerophospholipids to produce lysophosph

Protein Summary

• Protein general information: Q9UNK4  
  • Name: Group IID secretory phospholipase A2 (GIID sPLA2) (sPLA2 IID) (EC 3.1.1.4) (PLA2IID) (Phosphatidylcholine 2 acylhydrolase 2D) (Secretory type PLA, stroma associated homolog)
  • Length: 145  
  • Mass: 16546
  • Tissue specificity: Broadly expressed.
• Sequence:

  MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLK
  TQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC

• Structural information:
  • Interpro: IPR001211  IPR033112  IPR016090  IPR036444  IPR033113  
  • Prosite: PS00119 PS00118
  • CDD: cd00125
  • STRING: ENSP00000364246
• Other Databases: GeneCards:  PLA2G2D  Malacards:  PLA2G2D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IBA	molecular function
GO:0006644	phospholipid metabolic process	IBA	biological process
GO:0042130	negative regulation of T cell proliferation	IBA	biological process
GO:0004623	phospholipase A2 activity	IBA	molecular function
GO:0005543	phospholipid binding	IBA	molecular function
GO:0047498	calcium-dependent phospholipase A2 activity	IBA	molecular function
GO:0046470	phosphatidylcholine metabolic process	IDA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IDA	molecular function
GO:0046337	phosphatidylethanolamine metabolic process	ISS	biological process
GO:0002864	regulation of acute inflammatory response to antigenic stimulus	ISS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0050482	arachidonic acid secretion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0006954	inflammatory response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0006644	phospholipid metabolic process	TAS	biological process
GO:0102567	phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA	molecular function
GO:0102568	phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0036148	phosphatidylglycerol acyl-chain remodeling	TAS	biological process
GO:0036149	phosphatidylinositol acyl-chain remodeling	TAS	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0042130	negative regulation of T cell proliferation	IEA	biological process
GO:0050868	negative regulation of T cell activation	IEA	biological process
GO:0043395	heparan sulfate proteoglycan binding	IEA	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0002361	CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04014	Ras signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa00564	Glycerophospholipid metabolism
hsa04972	Pancreatic secretion
hsa00590	Arachidonic acid metabolism
hsa00565	Ether lipid metabolism
hsa04975	Fat digestion and absorption
hsa00591	Linoleic acid metabolism
hsa00592	alpha-Linolenic acid metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq