About Us

Search Result


Gene id 26277
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol TINF2   Gene   UCSC   Ensembl
Aliases DKCA3, TIN2
Gene name TERF1 interacting nuclear factor 2
Alternate names TERF1-interacting nuclear factor 2, TERF1 (TRF1)-interacting nuclear factor 2, TRF1-interacting nuclear protein 2,
Gene location 14q12 (149774067: 149776866)     Exons: 2     NC_000023.11
Gene summary(Entrez) This gene encodes one of the proteins of the shelterin, or telosome, complex which protects telomeres by allowing the cell to distinguish between telomeres and regions of DNA damage. The protein encoded by this gene is a critical part of shelterin; it int
OMIM 604319

Protein Summary

Protein general information Q9BSI4  

Name: TERF1 interacting nuclear factor 2 (TRF1 interacting nuclear protein 2)

Length: 451  Mass: 50023

Tissue specificity: Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Sequence MATPLVAGPAALRFAAAASWQVVRGRCVEHFPRVLEFLRSLRAVAPGLVRYRHHERLCMGLKAKVVVELILQGRP
WAQVLKALNHHFPESGPIVRDPKATKQDLRKILEAQETFYQQVKQLSEAPVDLASKLQELEQEYGEPFLAAMEKL
LFEYLCQLEKALPTPQAQQLQDVLSWMQPGVSITSSLAWRQYGVDMGWLLPECSVTDSVNLAEPMEQNPPQQQRL
ALHNPLPKAKPGTHLPQGPSSRTHPEPLAGRHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVI
SKPESKEEHAIYTADLAMGTRAASTGKSKSPCQTLGGRALKENPVDLPATEQKENCLDCYMDPLRLSLLPPRARK
PVCPPSLCSSVITIGDLVLDSDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCRDSSRP
L
Structural information
Interpro:  IPR039098  IPR029400  
CDD:   cd11657

PDB:  
3BQO 3BU8 5XYF
PDBsum:   3BQO 3BU8 5XYF

DIP:  

29413

MINT:  
STRING:   ENSP00000267415
Other Databases GeneCards:  TINF2  Malacards:  TINF2

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0070198 protein localization to c
hromosome, telomeric regi
on
IDA biological process
GO:0016233 telomere capping
IBA biological process
GO:0070187 shelterin complex
IBA cellular component
GO:0042162 telomeric DNA binding
IBA molecular function
GO:1904356 regulation of telomere ma
intenance via telomere le
ngthening
IBA biological process
GO:0016233 telomere capping
IEA biological process
GO:0070187 shelterin complex
IEA cellular component
GO:0000781 chromosome, telomeric reg
ion
IEA cellular component
GO:0005694 chromosome
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0016233 telomere capping
TAS biological process
GO:0016233 telomere capping
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0042162 telomeric DNA binding
IDA molecular function
GO:0000784 nuclear chromosome, telom
eric region
IDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0070187 shelterin complex
IDA cellular component
GO:0070187 shelterin complex
IDA cellular component
GO:0000784 nuclear chromosome, telom
eric region
IDA cellular component
GO:0070187 shelterin complex
IMP cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0000784 nuclear chromosome, telom
eric region
IDA cellular component
GO:0010836 negative regulation of pr
otein ADP-ribosylation
IDA biological process
GO:0005515 protein binding
IPI molecular function
GO:0000784 nuclear chromosome, telom
eric region
HDA cellular component
GO:0032211 negative regulation of te
lomere maintenance via te
lomerase
IMP biological process
GO:0003677 DNA binding
IDA NOT|molecular function
GO:0005515 protein binding
IPI molecular function
GO:0000781 chromosome, telomeric reg
ion
IDA cellular component
GO:0000781 chromosome, telomeric reg
ion
IDA cellular component
GO:0000783 nuclear telomere cap comp
lex
IDA cellular component
GO:0010370 perinucleolar chromocente
r
IDA cellular component
GO:0000784 nuclear chromosome, telom
eric region
IDA cellular component
GO:0016233 telomere capping
IMP biological process
GO:0050680 negative regulation of ep
ithelial cell proliferati
on
IMP biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:1904356 regulation of telomere ma
intenance via telomere le
ngthening
IMP biological process
GO:0032202 telomere assembly
IMP biological process
GO:0032211 negative regulation of te
lomere maintenance via te
lomerase
IGI biological process
GO:0070198 protein localization to c
hromosome, telomeric regi
on
IMP biological process
GO:0070198 protein localization to c
hromosome, telomeric regi
on
IMP biological process
GO:0016233 telomere capping
IC biological process
GO:0016363 nuclear matrix
IEA cellular component
GO:0000781 chromosome, telomeric reg
ion
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0016604 nuclear body
IDA cellular component
GO:0042162 telomeric DNA binding
IDA molecular function
GO:0005515 protein binding
IPI molecular function
Associated diseases References
Dyskeratosis congenita KEGG:H00507
Revesz syndrome KEGG:H00921
Dyskeratosis congenita KEGG:H00507
Revesz syndrome KEGG:H00921
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract