• Gene id: 26273

Gene Summary

• Gene Symbol: FBXO3   Gene   UCSC   Ensembl
• Aliases: FBA, FBX3
• Gene name: F-box protein 3
• Alternate names: F-box only protein 3, F-box protein FBX3,
• Gene location: 11p13 (31509766: 31790323)     Exons: 12     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
• OMIM: 609089

Protein Summary

• Protein general information: Q9UK99  
  • Name: F box only protein 3
  • Length: 471  
  • Mass: 54561
• Sequence:

  MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCW
  KSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPDDYRCSYRIHN
  GQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQC
  PDQMARNPAAIDMFIIGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVH
  PPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRVYEYTSCTTFSTTSGY
  MEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEYEEMEEEEEEEEEEDEDDDSADMDESDEDDE
  EERRRRVFDVPIRRRRCSRLF

• Structural information:
  • Protein Domains: (10..5-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080-)
    (278..40-)
    (/note="ApaG-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00412"-)
  • Interpro: IPR007474  IPR036767  IPR036047  IPR001810  IPR018958   IPR037883  
  • Prosite: PS51087 PS50181
  • PDB: 5HDW
  • PDBsum: 5HDW
  • DIP: 53688
  • STRING: ENSP00000265651
• Other Databases: GeneCards:  FBXO3  Malacards:  FBXO3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0006508	proteolysis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R