• Gene id: 26272

Gene Summary

• Gene Symbol: FBXO4   Gene   UCSC   Ensembl
• Aliases: FBX4
• Gene name: F-box protein 4
• Alternate names: F-box only protein 4, F-box protein Fbx4,
• Gene location: 5p13.1 (41918060: 42040229)     Exons: 9     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
• OMIM: 609090

Protein Summary

• Protein general information: Q9UKT5  
  • Name: F box only protein 4
  • Length: 387  
  • Mass: 44136
• Sequence:

  MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLTRLPIDVQLYILSFLS
  PHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVTDGAFFDYMAVYRMCCPYT
  RRASKSSRPMYGAVTSFLHSLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQL
  NNQHKFNILILYSTTRKERDRAREEHTSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKR
  HEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIE
  WILEEVESKRAR

• Structural information:
  • Protein Domains: (56..10-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080"-)
  • Interpro: IPR036047  IPR001810  IPR039588  
  • Prosite: PS50181
  • PDB: 3L2O 3L82
  • PDBsum: 3L2O 3L82
  • STRING: ENSP00000281623
• Other Databases: GeneCards:  FBXO4  Malacards:  FBXO4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0016567	protein ubiquitination	IDA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007568	aging	IEA	biological process
GO:0019725	cellular homeostasis	IEA	biological process
GO:0031648	protein destabilization	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:1900181	negative regulation of protein localization to nucleus	IEA	biological process
GO:1902916	positive regulation of protein polyubiquitination	IEA	biological process
GO:0010608	posttranscriptional regulation of gene expression	IEA	biological process
GO:0019005	SCF ubiquitin ligase complex	IEA	cellular component
GO:0035726	common myeloid progenitor cell proliferation	IEA	biological process
GO:0048147	negative regulation of fibroblast proliferation	IEA	biological process
GO:0071479	cellular response to ionizing radiation	IEA	biological process
GO:2000001	regulation of DNA damage checkpoint	IEA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0031647	regulation of protein stability	IDA	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032212	positive regulation of telomere maintenance via telomerase	IC	biological process
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881