About Us

Search Result


Gene id 26270
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol FBXO6   Gene   UCSC   Ensembl
Aliases FBG2, FBS2, FBX6, Fbx6b
Gene name F-box protein 6
Alternate names F-box only protein 6, F-box protein FBG2, F-box protein Fbx6, F-box protein that recognizes sugar chains 2, F-box/G-domain protein 2,
Gene location 1p36.22 (11664199: 11674353)     Exons: 11     NC_000001.11
Gene summary(Entrez) This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
OMIM 605647

Protein Summary

Protein general information Q9NRD1  

Name: F box only protein 6 (F box protein that recognizes sugar chains 2) (F box/G domain protein 2)

Length: 293  Mass: 33933

Sequence MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADW
KIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVA
EGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPR
GVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF
Structural information
Protein Domains
(10..5-)
(/note="F-box-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00080-)
(78..25-)
(/note="FBA-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00482"-)
Interpro:  IPR007397  IPR036047  IPR001810  IPR039752  IPR008979  
Prosite:   PS51114 PS50181
MINT:  
STRING:   ENSP00000365944
Other Databases GeneCards:  FBXO6  Malacards:  FBXO6

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005737 cytoplasm
IBA cellular component
GO:0006516 glycoprotein catabolic pr
ocess
IBA biological process
GO:0019005 SCF ubiquitin ligase comp
lex
IBA cellular component
GO:0030433 ubiquitin-dependent ERAD
pathway
IBA biological process
GO:0031146 SCF-dependent proteasomal
ubiquitin-dependent prot
ein catabolic process
IBA biological process
GO:0044322 endoplasmic reticulum qua
lity control compartment
IBA cellular component
GO:0061630 ubiquitin protein ligase
activity
IBA contributes to
GO:0031146 SCF-dependent proteasomal
ubiquitin-dependent prot
ein catabolic process
IDA biological process
GO:0019005 SCF ubiquitin ligase comp
lex
IDA cellular component
GO:0005737 cytoplasm
IDA cellular component
GO:0006281 DNA repair
TAS biological process
GO:0000077 DNA damage checkpoint
TAS biological process
GO:0030433 ubiquitin-dependent ERAD
pathway
ISS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
ISS molecular function
GO:0006281 DNA repair
IEA biological process
GO:0006986 response to unfolded prot
ein
IEA biological process
GO:0005737 cytoplasm
IEA cellular component
GO:0006974 cellular response to DNA
damage stimulus
IEA biological process
GO:0006508 proteolysis
TAS biological process
GO:0000209 protein polyubiquitinatio
n
TAS biological process
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0043687 post-translational protei
n modification
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0016567 protein ubiquitination
IEA biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04141Protein processing in endoplasmic reticulum
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract