• Gene id: 26270

Gene Summary

• Gene Symbol: FBXO6   Gene   UCSC   Ensembl
• Aliases: FBG2, FBS2, FBX6, Fbx6b
• Gene name: F-box protein 6
• Alternate names: F-box only protein 6, F-box protein FBG2, F-box protein Fbx6, F-box protein that recognizes sugar chains 2, F-box/G-domain protein 2,
• Gene location: 1p36.22 (11664199: 11674353)     Exons: 11     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
• OMIM: 605647

Protein Summary

• Protein general information: Q9NRD1  
  • Name: F box only protein 6 (F box protein that recognizes sugar chains 2) (F box/G domain protein 2)
  • Length: 293  
  • Mass: 33933
• Sequence:

  MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADW
  KIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVA
  EGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPR
  GVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF

• Structural information:
  • Protein Domains: (10..5-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080-)
    (78..25-)
    (/note="FBA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00482"-)
  • Interpro: IPR007397  IPR036047  IPR001810  IPR039752  IPR008979  
  • Prosite: PS51114 PS50181
  • STRING: ENSP00000365944
• Other Databases: GeneCards:  FBXO6  Malacards:  FBXO6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0006516	glycoprotein catabolic process	IBA	biological process
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0044322	endoplasmic reticulum quality control compartment	IBA	cellular component
GO:0061630	ubiquitin protein ligase activity	IBA	contributes to
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006281	DNA repair	TAS	biological process
GO:0000077	DNA damage checkpoint	TAS	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	ISS	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0006986	response to unfolded protein	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R