• Gene id: 26257

Gene Summary

• Gene Symbol: NKX2-8   Gene   UCSC   Ensembl
• Aliases: NKX2.8, NKX2H, Nkx2-9
• Gene name: NK2 homeobox 8
• Alternate names: homeobox protein Nkx-2.8, NK-2 homolog 8, NK-2 homolog H, NK2 transcription factor related, locus 8, homeobox protein NK-2 homolog H,
• Gene location: 14q13.3 (36582613: 36580003)     Exons: 2     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a homeobox-containing developmental regulator associated with liver development. The encoded protein binds to the alpha-fetoprotein (AFP) gene promoter and increases the expression of AFP. This gene is overexpressed in
• OMIM: 603261

Protein Summary

• Protein general information: O15522  
  • Name: Homeobox protein Nkx 2.8 (Homeobox protein NK 2 homolog H)
  • Length: 239  
  • Mass: 25866
• Sequence:

  MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRPSARPA
  SPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAES
  PDLAASAELHAAPGLLRRVVVPVLVRDGQPCGGGGGGEVGTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPA
  YQHLASPALVSWNW

• Structural information:
  • Interpro: IPR009057  IPR017970  IPR001356  IPR020479  
  • Prosite: PS00027 PS50071
  • CDD: cd00086
  • STRING: ENSP00000258829
• Other Databases: GeneCards:  NKX2-8  Malacards:  NKX2-8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0050680	negative regulation of epithelial cell proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007409	axonogenesis	IEA	biological process
GO:0030323	respiratory tube development	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0006351	transcription, DNA-templated	IDA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0001889	liver development	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881