• Gene id: 26256

Gene Summary

• Gene Symbol: CABYR   Gene   UCSC   Ensembl
• Aliases: CABYRa, CABYRc, CABYRc/d, CABYRe, CBP86, CT88, FSP-2, FSP2
• Gene name: calcium binding tyrosine phosphorylation regulated
• Alternate names: calcium-binding tyrosine phosphorylation-regulated protein, calcium binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2), calcium-binding protein 86, cancer/testis antigen 88, fibrousheathin II, fibrousheathin-2, testis tissue sperm-binding p,
• Gene location: 18q11.2 (24138955: 24161599)     Exons: 9     NC_000018.10
• Gene summary(Entrez): To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene lo
• OMIM: 612135

Protein Summary

• Protein general information: O75952  
  • Name: Calcium binding tyrosine phosphorylation regulated protein (Calcium binding protein 86) (Cancer/testis antigen 88) (CT88) (Fibrousheathin II) (Fibrousheathin 2) (FSP 2) (Testis specific calcium binding protein CBP86)
  • Length: 493  
  • Mass: 52,774
• Sequence:

  MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEGTT
  PQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTT
  TPPSSPPPTAVSPEFAYVPADPAQLAAQMLGKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEAAEDVMVAAPLV
  CSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAYDQAPEVTLQADIEVMSTVHISSVYNDV
  PVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSVESVKLAQLEENAKYS
  SVYMEAEATALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLHLEVEITSIVSDNTGQEESGENSVPQEMEGKPV
  LSGEAAEAVHSGTSVKSSSGPFPPAPEGLTAPEIEPEGESTAE

• Structural information:
  • Protein Domains: RIIa. (12-49)
  • Interpro: IPR003117  
  • STRING: ENSP00000432870
• Other Databases: GeneCards:  CABYR  Malacards:  CABYR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003351	epithelial cilium movement	NAS	biological process
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0017124	SH3 domain binding	NAS	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0031514	motile cilium	IDA	cellular component
GO:0035686	sperm fibrous sheath	IDA	cellular component
GO:0046982	protein heterodimerization activity	ISS	molecular function
GO:0048240	sperm capacitation	NAS	biological process
GO:0097228	sperm principal piece	IEA	cellular component
GO:0097229	sperm end piece	IEA	cellular component
GO:0003351	epithelial cilium movement	NAS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0017124	SH3 domain binding	NAS	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0031514	motile cilium	IEA	cellular component
GO:0031514	motile cilium	IEA	cellular component
GO:0031514	motile cilium	IDA	cellular component
GO:0035686	sperm fibrous sheath	IEA	cellular component
GO:0035686	sperm fibrous sheath	IDA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0046982	protein heterodimerization activity	ISS	molecular function
GO:0048240	sperm capacitation	NAS	biological process
GO:0097228	sperm principal piece	IEA	cellular component
GO:0097229	sperm end piece	IEA	cellular component
GO:0003351	epithelial cilium movement	NAS	biological process
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0017124	SH3 domain binding	NAS	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0031514	motile cilium	IDA	cellular component
GO:0035686	sperm fibrous sheath	IDA	cellular component
GO:0046982	protein heterodimerization activity	ISS	molecular function
GO:0048240	sperm capacitation	NAS	biological process

Diseases

Associated diseases	References
Asthenozoospermia	MIK: 25717016
Asthenozoospermia	MIK: 25717016
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 25717016
Male infertility	MIK: 29247344
Hypospermatogenesis	MIK: 28361989
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Participates in the assembly of complexes in the Fibrous sheath	MIK: 20731842
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25717016	Asthenozoospermia				Male infertility
20731842	Participates in the assembly of complexes in the Fibrous sheath				Male infertility
29247344	Asthenozoospermia, Male infertility		Caucasi an	120 (60 normozoospermic and 60 asthenozoospermic)	Male infertility	ROPN1 CABYR
27802166	Formation of fibrous sheath, Male infertility				Male infertility
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray