• Gene id: 26233

Gene Summary

• Gene Symbol: FBXL6   Gene   UCSC   Ensembl
• Aliases: FBL6, FBL6A, PP14630
• Gene name: F-box and leucine rich repeat protein 6
• Alternate names: F-box/LRR-repeat protein 6, F-box protein Fbl6,
• Gene location: 8q24.3 (144358471: 144355430)     Exons: 9     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of a family of proteins that are characterized by an F-box motif. The encoded protein also contains leucine-rich repeats. F-box-containing proteins comprise one of the subunits of the SCF (SKP1-cullin-F-box) complex, which funct
• OMIM: 603787

Protein Summary

• Protein general information: Q8N531  
  • Name: F box/LRR repeat protein 6 (F box and leucine rich repeat protein 6) (F box protein FBL6) (FBL6A)
  • Length: 539  
  • Mass: 58588
• Sequence:

  MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQRRASRRTPRQPPRGP
  SAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEILVQIFGLLVAADGPMPFLGRAARVCRRWQEA
  ASQPALWHTVTLSSPLVGRPAKGGVKAEKKLLASLEWLMPNRFSQLQRLTLIHWKSQVHPVLKLVGECCPRLTFL
  KLSGCHGVTADALVMLAKACCQLHSLDLQHSMVESTAVVSFLEEAGSRMRKLWLTYSSQTTAILGALLGSCCPQL
  QVLEVSTGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVAPGPGFPSLEELCLASSTCNFVSNEV
  LGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGTSDRLTLAKEGSPFLTQKWCHTLRELDLSGQ
  GFSEKDLEQALAAFLSTPGGSHPALCSLNLRGTRVTPSTVSSVISSCPGLLYLNLESCRCLPRGLKRAYRGLEEV
  QWCLEQLLTSPSPS

• Structural information:
  • Protein Domains: (10..16-)
    (/note="F-box"-)
  • Interpro: IPR036047  IPR001810  IPR001611  IPR006553  IPR032675  
  • STRING: ENSP00000330098
• Other Databases: GeneCards:  FBXL6  Malacards:  FBXL6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0006508	proteolysis	TAS	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0006508	proteolysis	TAS	biological process
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq