• Gene id: 26232

Gene Summary

• Gene Symbol: FBXO2   Gene   UCSC   Ensembl
• Aliases: FBG1, FBX2, Fbs1, NFB42, OCP1
• Gene name: F-box protein 2
• Alternate names: F-box only protein 2, F-box gene 1, organ of Corti protein 1,
• Gene location: 1p36.22 (50343326: 50445089)     Exons: 29     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
• OMIM: 607112

Protein Summary

• Protein general information: Q9UK22  
  • Name: F box only protein 2
  • Length: 296  
  • Mass: 33328
• Sequence:

  MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVC
  LRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEE
  LPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLS
  EHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP

• Structural information:
  • Protein Domains: (44..9-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080-)
    (113..29-)
    (/note="FBA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00482"-)
  • Interpro: IPR007397  IPR036047  IPR001810  IPR039752  IPR008979  
  • Prosite: PS51114 PS50181
  • STRING: ENSP00000346240
• Other Databases: GeneCards:  FBXO2  Malacards:  FBXO2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IDA	cellular component
GO:0061630	ubiquitin protein ligase activity	IBA	contributes to
GO:0005737	cytoplasm	IBA	cellular component
GO:0006516	glycoprotein catabolic process	IBA	biological process
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0019005	SCF ubiquitin ligase complex	ISS	cellular component
GO:0016567	protein ubiquitination	ISS	biological process
GO:0006516	glycoprotein catabolic process	ISS	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0006464	cellular protein modification process	TAS	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0031396	regulation of protein ubiquitination	IEA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0019005	SCF ubiquitin ligase complex	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0006516	glycoprotein catabolic process	IEA	biological process
GO:0001540	amyloid-beta binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray