• Gene id: 26231

Gene Summary

• Gene Symbol: LRRC29   Gene   UCSC   Ensembl
• Aliases: FBL9, FBXL9
• Gene name: leucine rich repeat containing 29
• Alternate names: leucine-rich repeat-containing protein 29, F-box and leucine-rich repeat protein 9, F-box protein FBL9, F-box/LRR-repeat protein 9,
• Gene location: 16q22.1 (67227061: 67207138)     Exons: 9     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w

Protein Summary

• Protein general information: Q8WV35  
  • Name: Leucine rich repeat containing protein 29 (F box and leucine rich repeat protein 9) (F box protein FBL9) (F box/LRR repeat protein 9)
  • Length: 223  
  • Mass: 23797
  • Tissue specificity: Expressed in heart, kidney, liver, lung and pancreas. {ECO
• Sequence:

  MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPSLLTLR
  ALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASS
  WPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL

• Structural information:
  • Protein Domains: (134..18-)
    (/note="F-box"-)
  • Interpro: IPR001611  IPR006553  IPR032675  
  • STRING: ENSP00000387318
• Other Databases: GeneCards:  LRRC29  Malacards:  LRRC29

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray