• Gene id: 26228

Gene Summary

• Gene Symbol: STAP1   Gene   UCSC   Ensembl
• Aliases: BRDG1, STAP-1
• Gene name: signal transducing adaptor family member 1
• Alternate names: signal-transducing adaptor protein 1, BCR downstream-signaling protein 1, docking protein BRDG1, stem cell adaptor protein 1,
• Gene location: 4q13.2 (241635929: 241628863)     Exons: 1     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene contains a proline-rich region, a pleckstrin homology (PH) domain, and a region in the carboxy terminal half with similarity to the Src Homology 2 (SH2) domain. This protein is a substrate of tyrosine-protein kinase Tec, a
• OMIM: 604298

Protein Summary

• Protein general information: Q9ULZ2  
  • Name: Signal transducing adaptor protein 1 (STAP 1) (BCR downstream signaling protein 1) (Docking protein BRDG1) (Stem cell adaptor protein 1)
  • Length: 295  
  • Mass: 34291
• Sequence:

  MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLIKRSGYREYEHYWTELRGTTLFFYTDKKSIIYVDKLDIVDLT
  CLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVTELSVPQNVSLLPGQVIKLHEVLEREKKRRI
  ETEQSTSVEKEKEPTEDYVDVLNPMPACFYTVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIK
  HYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPHIA

• Structural information:
  • Protein Domains: (25..12-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (177..28-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191"-)
  • Interpro: IPR011993  IPR001849  IPR000980  IPR036860  IPR039111   IPR035877  
  • Prosite: PS50003 PS50001
  • CDD: cd10403
  • PDB: 1X1F 3MAZ
  • PDBsum: 1X1F 3MAZ
  • STRING: ENSP00000265404
• Other Databases: GeneCards:  STAP1  Malacards:  STAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0035591	signaling adaptor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005068	transmembrane receptor protein tyrosine kinase adaptor activity	IEA	molecular function
GO:0005157	macrophage colony-stimulating factor receptor binding	IEA	molecular function
GO:0009617	response to bacterium	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0010760	negative regulation of macrophage chemotaxis	IEA	biological process
GO:0042326	negative regulation of phosphorylation	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:1903980	positive regulation of microglial cell activation	IEA	biological process
GO:1904151	positive regulation of microglial cell mediated cytotoxicity	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0060100	positive regulation of phagocytosis, engulfment	IEA	biological process
GO:1900028	negative regulation of ruffle assembly	IEA	biological process
GO:1902227	negative regulation of macrophage colony-stimulating factor signaling pathway	IEA	biological process
GO:1904140	negative regulation of microglial cell migration	IEA	biological process
GO:2000251	positive regulation of actin cytoskeleton reorganization	IEA	biological process
GO:1904151	positive regulation of microglial cell mediated cytotoxicity	ISS	biological process
GO:0035591	signaling adaptor activity	IPI	molecular function
GO:0005068	transmembrane receptor protein tyrosine kinase adaptor activity	ISS	molecular function
GO:0001784	phosphotyrosine residue binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005543	phospholipid binding	NAS	molecular function
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010760	negative regulation of macrophage chemotaxis	ISS	biological process
GO:0042326	negative regulation of phosphorylation	ISS	biological process
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:1903980	positive regulation of microglial cell activation	ISS	biological process
GO:0050861	positive regulation of B cell receptor signaling pathway	IDA	biological process
GO:1903997	positive regulation of non-membrane spanning protein tyrosine kinase activity	IDA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	ISS	biological process
GO:0060100	positive regulation of phagocytosis, engulfment	ISS	biological process
GO:1900028	negative regulation of ruffle assembly	ISS	biological process
GO:1902227	negative regulation of macrophage colony-stimulating factor signaling pathway	ISS	biological process
GO:2000251	positive regulation of actin cytoskeleton reorganization	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R