Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 2622
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol GAS8   Gene   UCSC   Ensembl
Aliases CILD33, DRC4, GAS11
Gene name growth arrest specific 8
Alternate names dynein regulatory complex subunit 4, GAS-11, epididymis secretory sperm binding protein, growth arrest-specific protein 11, growth arrest-specific protein 8,
Gene location 16q24.3 (90019628: 90044970)     Exons: 15     NC_000016.10
Gene summary(Entrez) This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation.
OMIM 125305

Protein Summary
Protein general information O95995  

Name: Dynein regulatory complex subunit 4 (Growth arrest specific protein 11) (GAS 11) (Growth arrest specific protein 8) (GAS 8)

Length: 478  Mass: 56356

Tissue specificity: Expressed in respiratory epithelial cells (at protein level) (PubMed

Sequence MAPKKKGKKGKAKGTPIVDGLAPEDMSKEQVEEHVSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKA
ELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLTEMKAEGTVVMKLAQKEHRIQESVLRKDMRALKVELK
EQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKKMKMLRDELDLRRKTELHEVEERKNGQIHTLMQR
HEEAFTDIKNYYNDITLNNLALINSLKEQMEDMRKKEDHLEREMAEVSGQNKRLADPLQKAREEMSEMQKQLANY
ERDKQILLCTKARLKVREKELKDLQWEHEVLEQRFTKVQQERDELYRKFTAAIQEVQQKTGFKNLVLERKLQALS
AAVEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLD
NVGFKPLETAVIGQTLGQGPAGLVGTPT
Structural information
Interpro:  IPR039308  IPR025593  
STRING:   ENSP00000268699
Other Databases GeneCards:  GAS8  Malacards:  GAS8

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005794 Golgi apparatus
 IBA cellular component
GO:0017137 Rab GTPase binding
 IBA molecular function
GO:0005874 microtubule
 IBA cellular component
GO:0030317 flagellated sperm motilit
y
 IBA biological process
GO:0034613 cellular protein localiza
tion
 IBA biological process
GO:0005930 axoneme
 IDA cellular component
GO:0005930 axoneme
 IDA cellular component
GO:0031514 motile cilium
 IDA cellular component
GO:0005929 cilium
 IDA cellular component
GO:0005929 cilium
 IDA cellular component
GO:0036064 ciliary basal body
 ISS cellular component
GO:0008017 microtubule binding
 ISS molecular function
GO:1904526 regulation of microtubule
binding
 ISS biological process
GO:0045880 positive regulation of sm
oothened signaling pathwa
y
 ISS biological process
GO:0035082 axoneme assembly
 IMP biological process
GO:1903566 positive regulation of pr
otein localization to cil
ium
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0008017 microtubule binding
 IEA molecular function
GO:0017137 Rab GTPase binding
 IEA molecular function
GO:0048870 cell motility
 IEA biological process
GO:0031514 motile cilium
 IEA cellular component
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0042995 cell projection
 IEA cellular component
GO:0031514 motile cilium
 IEA cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005874 microtubule
 IEA cellular component
GO:0005929 cilium
 IEA cellular component
GO:0008285 negative regulation of ce
ll population proliferati
on
 TAS biological process
GO:0005930 axoneme
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:1904526 regulation of microtubule
binding
 IEA biological process
GO:0036064 ciliary basal body
 IEA cellular component
GO:0017137 Rab GTPase binding
 IEA molecular function
GO:0015630 microtubule cytoskeleton
 IEA cellular component
GO:0008017 microtubule binding
 IEA molecular function
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0003351 epithelial cilium movemen
t involved in extracellul
ar fluid movement
 IEA biological process
GO:1903566 positive regulation of pr
otein localization to cil
ium
 IEA biological process
GO:0097729 9+2 motile cilium
 IEA cellular component
GO:0045880 positive regulation of sm
oothened signaling pathwa
y
 IEA biological process
GO:0036126 sperm flagellum
 IEA cellular component
GO:0035082 axoneme assembly
 IEA biological process
GO:0034613 cellular protein localiza
tion
 IEA biological process
GO:0031514 motile cilium
 IEA cellular component
GO:0030317 flagellated sperm motilit
y
 IEA biological process
GO:0007420 brain development
 IEA biological process
GO:0007368 determination of left/rig
ht symmetry
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005794 Golgi apparatus
 IEA cellular component
GO:0005929 cilium
 IEA cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0031514 motile cilium
 IEA cellular component
GO:0060294 cilium movement involved
in cell motility
 IMP biological process
GO:0005576 extracellular region
 IEA cellular component
GO:0005874 microtubule
 IDA cellular component
GO:0031514 motile cilium
 ISS cellular component
GO:0030317 flagellated sperm motilit
y
 ISS biological process
GO:0003674 molecular_function
 ND molecular function

Diseases

Expand All | Collapse All
Associated diseases References
Primary ciliary dyskinesia KEGG:H00564
Primary ciliary dyskinesia KEGG:H00564
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract