• Gene id: 2621

Gene Summary

• Gene Symbol: GAS6   Gene   UCSC   Ensembl
• Aliases: AXLLG, AXSF
• Gene name: growth arrest specific 6
• Alternate names: growth arrest-specific protein 6, AXL receptor tyrosine kinase ligand, AXL stimulatory factor,
• Gene location: 13q34 (113864102: 113820548)     Exons: 15     NC_000013.11
• Gene summary(Entrez): This gene encodes a gamma-carboxyglutamic acid (Gla)-containing protein thought to be involved in the stimulation of cell proliferation. This gene is frequently overexpressed in many cancers and has been implicated as an adverse prognostic marker. Elevate
• OMIM: 600441

Protein Summary

• Protein general information: Q14393  
  • Name: Growth arrest specific protein 6 (GAS 6) (AXL receptor tyrosine kinase ligand)
  • Length: 721  
  • Mass: 79,677
  • Tissue specificity: Present in most tissues, including lung, with the strongest expression in brain, colon, kidney, and testis. In sperm and testis, detected in particular in pachytene primary spermatocytes. Up-regulated in pancreatic tumor tissues and no
• Sequence:

  MAPSLSPGPAALRRAPQLLLLLLAAECALAALLPAREATQFLRPRQRRAFQVFEEAKQGHLERECVEELCSREEA
  REVFENDPETDYFYPRYLDCINKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNFFCLCKAGWGG
  RLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFELSSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDE
  GFAYSSQEKACRDVDECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCELEAGWPCPRHRRDGSPAARPGR
  GAQGSRSEGHIPDRRGPRPWQDILPCVPFSVAKSVKSLYLGRMFSGTPVIRLRFKRLQPTRLVAEFDFRTFDPEG
  ILLFAGGHQDSTWIVLALRAGRLELQLRYNGVGRVTSSGPVINHGMWQTISVEELARNLVIKVNRDAVMKIAVAG
  DLFQPERGLYHLNLTVGGIPFHEKDLVQPINPRLDGCMRSWNWLNGEDTTIQETVKVNTRMQCFSVTERGSFYPG
  SGFAFYSLDYMRTPLDVGTESTWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVVLAV
  EHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVT
  SAPVTAFYRGCMTLEVNRRLLDLDEAAYKHSDITAHSCPPVEPAAA

• Structural information:
  • Protein Domains: Gla. (53-94)
    EGF-like (116-154)
    ({ECO:0000255|PROSITE-ProRule:PRU00076}-)
    EGF-like (156-196)
    ({ECO:0000255|PROSITE-ProRule:PRU00076}-)
    EGF-like (197-237)
  • Interpro: IPR026823  IPR017857  IPR013320  IPR001881  IPR013032   IPR000742  IPR000152  IPR018097  IPR035972  IPR000294  IPR009030  IPR001791  
  • Prosite: PS00010 PS00022 PS01186 PS50026 PS01187 PS00011 PS50998 PS50025
  • PDB: 1H30 2C5D 4RA0 5VXZ
  • PDBsum: 1H30 2C5D 4RA0 5VXZ
• Other Databases: GeneCards:  GAS6  Malacards:  GAS6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001764	neuron migration	IEA	biological process
GO:0001786	phosphatidylserine binding	IDA	molecular function
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001961	positive regulation of cytokine-mediated signaling pathway	IMP	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0003104	positive regulation of glomerular filtration	ISS	biological process
GO:0005102	receptor binding	IDA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005245	voltage-gated calcium channel activity	IDA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006465	signal peptide processing	TAS	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006888	ER to Golgi vesicle-mediated transport	TAS	biological process
GO:0006909	phagocytosis	IDA	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	IDA	biological process
GO:0007165	signal transduction	IDA	biological process
GO:0007167	enzyme linked receptor protein signaling pathway	IEA	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0009267	cellular response to starvation	IEA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	biological process
GO:0010934	macrophage cytokine production	IEA	biological process
GO:0016477	cell migration	TAS	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0019064	fusion of virus membrane with host plasma membrane	IDA	biological process
GO:0019079	viral genome replication	IDA	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0030296	protein tyrosine kinase activator activity	IDA	molecular function
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0031100	animal organ regeneration	IEA	biological process
GO:0031589	cell-substrate adhesion	IEA	biological process
GO:0032008	positive regulation of TOR signaling	ISS	biological process
GO:0032148	activation of protein kinase B activity	ISS	biological process
GO:0032689	negative regulation of interferon-gamma production	IDA	biological process
GO:0032715	negative regulation of interleukin-6 production	IDA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0032825	positive regulation of natural killer cell differentiation	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0033159	negative regulation of protein import into nucleus, translocation	IDA	biological process
GO:0035457	cellular response to interferon-alpha	IDA	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0035754	B cell chemotaxis	IDA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0043277	apoptotic cell clearance	IDA	biological process
GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	IDA	biological process
GO:0043491	protein kinase B signaling	IDA	biological process
GO:0043491	protein kinase B signaling	IDA	biological process
GO:0045860	positive regulation of protein kinase activity	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0046718	viral entry into host cell	IDA	biological process
GO:0046813	receptor-mediated virion attachment to host cell	IDA	biological process
GO:0046827	positive regulation of protein export from nucleus	IDA	biological process
GO:0048018	receptor agonist activity	IDA	molecular function
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0050711	negative regulation of interleukin-1 secretion	IDA	biological process
GO:0050766	positive regulation of phagocytosis	IDA	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0060090	binding, bridging	IDA	molecular function
GO:0061098	positive regulation of protein tyrosine kinase activity	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070168	negative regulation of biomineral tissue development	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070527	platelet aggregation	TAS	biological process
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0071307	cellular response to vitamin K	IDA	biological process
GO:0071333	cellular response to glucose stimulus	ISS	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0072661	protein targeting to plasma membrane	IDA	biological process
GO:0085029	extracellular matrix assembly	ISS	biological process
GO:0097028	dendritic cell differentiation	IEP	biological process
GO:0097241	hematopoietic stem cell migration to bone marrow	IDA	biological process
GO:1900142	negative regulation of oligodendrocyte apoptotic process	IDA	biological process
GO:1900165	negative regulation of interleukin-6 secretion	IDA	biological process
GO:2000270	negative regulation of fibroblast apoptotic process	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2000510	positive regulation of dendritic cell chemotaxis	IDA	biological process
GO:2000533	negative regulation of renal albumin absorption	ISS	biological process
GO:2000669	negative regulation of dendritic cell apoptotic process	IDA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0001786	phosphatidylserine binding	IDA	molecular function
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001961	positive regulation of cytokine-mediated signaling pathway	IMP	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0003104	positive regulation of glomerular filtration	IEA	biological process
GO:0003104	positive regulation of glomerular filtration	ISS	biological process
GO:0005102	receptor binding	IDA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005245	voltage-gated calcium channel activity	IDA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005622	intracellular	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006465	signal peptide processing	TAS	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006888	ER to Golgi vesicle-mediated transport	TAS	biological process
GO:0006909	phagocytosis	IDA	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	IDA	biological process
GO:0007165	signal transduction	IDA	biological process
GO:0007167	enzyme linked receptor protein signaling pathway	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0009267	cellular response to starvation	IEA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	biological process
GO:0010934	macrophage cytokine production	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0016477	cell migration	TAS	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0019064	fusion of virus membrane with host plasma membrane	IDA	biological process
GO:0019079	viral genome replication	IDA	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0030296	protein tyrosine kinase activator activity	IDA	molecular function
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0031100	animal organ regeneration	IEA	biological process
GO:0031589	cell-substrate adhesion	IEA	biological process
GO:0032008	positive regulation of TOR signaling	IEA	biological process
GO:0032008	positive regulation of TOR signaling	ISS	biological process
GO:0032148	activation of protein kinase B activity	IEA	biological process
GO:0032148	activation of protein kinase B activity	ISS	biological process
GO:0032689	negative regulation of interferon-gamma production	IDA	biological process
GO:0032715	negative regulation of interleukin-6 production	IDA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0032825	positive regulation of natural killer cell differentiation	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0033159	negative regulation of protein import into nucleus, translocation	IDA	biological process
GO:0035457	cellular response to interferon-alpha	IDA	biological process
GO:0035690	cellular response to drug	IEA	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0035754	B cell chemotaxis	IDA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0043277	apoptotic cell clearance	IEA	biological process
GO:0043277	apoptotic cell clearance	IDA	biological process
GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	IDA	biological process
GO:0043491	protein kinase B signaling	IEA	biological process
GO:0043491	protein kinase B signaling	IDA	biological process
GO:0043491	protein kinase B signaling	IDA	biological process
GO:0045860	positive regulation of protein kinase activity	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0046718	viral entry into host cell	IDA	biological process
GO:0046813	receptor-mediated virion attachment to host cell	IDA	biological process
GO:0046827	positive regulation of protein export from nucleus	IDA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048018	receptor agonist activity	IEA	molecular function
GO:0048018	receptor agonist activity	IDA	molecular function
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0050711	negative regulation of interleukin-1 secretion	IDA	biological process
GO:0050766	positive regulation of phagocytosis	IDA	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0060090	binding, bridging	IDA	molecular function
GO:0061098	positive regulation of protein tyrosine kinase activity	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070168	negative regulation of biomineral tissue development	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070527	platelet aggregation	TAS	biological process
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0071307	cellular response to vitamin K	IDA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071333	cellular response to glucose stimulus	ISS	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0072661	protein targeting to plasma membrane	IDA	biological process
GO:0085029	extracellular matrix assembly	IEA	biological process
GO:0085029	extracellular matrix assembly	ISS	biological process
GO:0097028	dendritic cell differentiation	IEP	biological process
GO:0097241	hematopoietic stem cell migration to bone marrow	IDA	biological process
GO:1900142	negative regulation of oligodendrocyte apoptotic process	IDA	biological process
GO:1900165	negative regulation of interleukin-6 secretion	IDA	biological process
GO:2000270	negative regulation of fibroblast apoptotic process	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2000510	positive regulation of dendritic cell chemotaxis	IDA	biological process
GO:2000533	negative regulation of renal albumin absorption	IEA	biological process
GO:2000533	negative regulation of renal albumin absorption	ISS	biological process
GO:2000669	negative regulation of dendritic cell apoptotic process	IDA	biological process
GO:0001786	phosphatidylserine binding	IDA	molecular function
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001961	positive regulation of cytokine-mediated signaling pathway	IMP	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0003104	positive regulation of glomerular filtration	ISS	biological process
GO:0005102	receptor binding	IDA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005245	voltage-gated calcium channel activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006465	signal peptide processing	TAS	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006888	ER to Golgi vesicle-mediated transport	TAS	biological process
GO:0006909	phagocytosis	IDA	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	IDA	biological process
GO:0007165	signal transduction	IDA	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	biological process
GO:0016477	cell migration	TAS	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0019064	fusion of virus membrane with host plasma membrane	IDA	biological process
GO:0019079	viral genome replication	IDA	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0030296	protein tyrosine kinase activator activity	IDA	molecular function
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0032008	positive regulation of TOR signaling	ISS	biological process
GO:0032148	activation of protein kinase B activity	ISS	biological process
GO:0032689	negative regulation of interferon-gamma production	IDA	biological process
GO:0032715	negative regulation of interleukin-6 production	IDA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0032825	positive regulation of natural killer cell differentiation	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0033159	negative regulation of protein import into nucleus, translocation	IDA	biological process
GO:0035457	cellular response to interferon-alpha	IDA	biological process
GO:0035690	cellular response to drug	IDA	biological process
GO:0035754	B cell chemotaxis	IDA	biological process
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0043277	apoptotic cell clearance	IDA	biological process
GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	IDA	biological process
GO:0043491	protein kinase B signaling	IDA	biological process
GO:0043491	protein kinase B signaling	IDA	biological process
GO:0045860	positive regulation of protein kinase activity	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0046718	viral entry into host cell	IDA	biological process
GO:0046813	receptor-mediated virion attachment to host cell	IDA	biological process
GO:0046827	positive regulation of protein export from nucleus	IDA	biological process
GO:0048018	receptor agonist activity	IDA	molecular function
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0050711	negative regulation of interleukin-1 secretion	IDA	biological process
GO:0050766	positive regulation of phagocytosis	IDA	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0060090	binding, bridging	IDA	molecular function
GO:0061098	positive regulation of protein tyrosine kinase activity	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070168	negative regulation of biomineral tissue development	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070527	platelet aggregation	TAS	biological process
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0071307	cellular response to vitamin K	IDA	biological process
GO:0071333	cellular response to glucose stimulus	ISS	biological process
GO:0072661	protein targeting to plasma membrane	IDA	biological process
GO:0085029	extracellular matrix assembly	ISS	biological process
GO:0097028	dendritic cell differentiation	IEP	biological process
GO:0097241	hematopoietic stem cell migration to bone marrow	IDA	biological process
GO:1900142	negative regulation of oligodendrocyte apoptotic process	IDA	biological process
GO:1900165	negative regulation of interleukin-6 secretion	IDA	biological process
GO:2000270	negative regulation of fibroblast apoptotic process	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2000510	positive regulation of dendritic cell chemotaxis	IDA	biological process
GO:2000533	negative regulation of renal albumin absorption	ISS	biological process
GO:2000669	negative regulation of dendritic cell apoptotic process	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01521	EGFR tyrosine kinase inhibitor resistance

Diseases

Associated diseases	References
Apoplexy	GAD: 17721624
Atherosclerosis	GAD: 20664904
Cardiovascular disease	GAD: 19369636
Stroke	GAD: 15108283
Ovarian endometriosis	INFBASE: 12029073
Male factor infertility	MIK: 24762434
Sticky platelet syndrome	GAD: 19696043
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 24762434

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24762434	Male infertility		Japanes e, Chin ese	186 (47 NOA, 11 OA, 20 NOA, 10 OA, 18 healthy Chinese men with children, 12 healthy men who were semen donors, 15 healthy volunteers, 42 Chinese patients with NOA, 11 Chinese patients with OA)	Male infertility
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq