• Gene id: 2620

Gene Summary

• Gene Symbol: GAS2   Gene   UCSC   Ensembl
• Aliases: GAS-2
• Gene name: growth arrest specific 2
• Alternate names: growth arrest-specific protein 2,
• Gene location: 11p14.3 (22627757: 22885929)     Exons: 17     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Alternativ
• OMIM: 601867

Protein Summary

• Protein general information: O43903  
  • Name: Growth arrest specific protein 2 (GAS 2)
  • Length: 313  
  • Mass: 34945
  • Tissue specificity: Ubiquitously expressed with highest levels in liver, lung, and kidney. Not found in spleen.
• Sequence:

  MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQ
  EKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHKQPREVCLCLL
  ELGRIAARYGVEPPGLIKLEKEIEQEETLSAPSPSPSPSSKSSGKKSTGNLLDDAVKRISEDPPCKCPNKFCVER
  LSQGRYRVGEKILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYL
  VVSASYKAKKEIK

• Structural information:
  • Protein Domains: (34..15-)
    (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00044-)
    (197..27-)
    (/note="GAR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00792"-)
  • Interpro: IPR001715  IPR036872  IPR003108  IPR036534  IPR029929  
  • Prosite: PS50021 PS51460
  • CDD: cd00014
  • STRING: ENSP00000401145
• Other Databases: GeneCards:  GAS2  Malacards:  GAS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051015	actin filament binding	IBA	molecular function
GO:0008017	microtubule binding	IBA	molecular function
GO:0051764	actin crosslink formation	IBA	biological process
GO:0008093	cytoskeletal anchor activity	IBA	molecular function
GO:0005884	actin filament	IBA	cellular component
GO:0005874	microtubule	IBA	cellular component
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0007050	cell cycle arrest	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005884	actin filament	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0001544	initiation of primordial ovarian follicle growth	IEA	biological process
GO:0001547	antral ovarian follicle growth	IEA	biological process
GO:0030728	ovulation	IEA	biological process
GO:0008593	regulation of Notch signaling pathway	IEA	biological process
GO:0071711	basement membrane organization	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881