• Gene id: 2619

Gene Summary

• Gene Symbol: GAS1   Gene   UCSC   Ensembl
• Gene name: growth arrest specific 1
• Alternate names: growth arrest-specific protein 1, GAS-1, Growth arrest-specific gene-1,
• Gene location: 9q21.33 (86947505: 86944361)     Exons: 1     NC_000009.12
• Gene summary(Entrez): Growth arrest-specific 1 plays a role in growth suppression. GAS1 blocks entry to S phase and prevents cycling of normal and transformed cells. Gas1 is a putative tumor suppressor gene. [provided by RefSeq, Jul 2008]
• OMIM: 139185

Protein Summary

• Protein general information: P54826  
  • Name: Growth arrest specific protein 1 (GAS 1)
  • Length: 345  
  • Mass: 35693
• Sequence:

  MVAALLGGGGEARGGTVPGAWLCLMALLQLLGSAPRGSGLAHGRRLICWQALLQCQGEPECSYAYNQYAEACAPV
  LAQHGGGDAPGAAAAAFPASAASFSSRWRCPSHCISALIQLNHTRRGPALEDCDCAQDENCKSTKRAIEPCLPRT
  SGGGAGGPGAGGVMGCTEARRRCDRDSRCNLALSRYLTYCGKVFNGLRCTDECRTVIEDMLAMPKAALLNDCVCD
  GLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDGVPHPPRPGSGA
  AASGGRGDLPYGPGRRSSGGGGRLAPRGAWTPLASILLLLLGPLF

• Structural information:
  • Interpro: IPR039596  IPR016017  
  • STRING: ENSP00000298743
• Other Databases: GeneCards:  GAS1  Malacards:  GAS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045930	negative regulation of mitotic cell cycle	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0007050	cell cycle arrest	IEA	biological process
GO:0007050	cell cycle arrest	IEA	biological process
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0045930	negative regulation of mitotic cell cycle	IGI	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0045930	negative regulation of mitotic cell cycle	IDA	biological process
GO:0046658	anchored component of plasma membrane	ISS	cellular component
GO:0048589	developmental growth	ISS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0010955	negative regulation of protein processing	IMP	biological process
GO:0008589	regulation of smoothened signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0060628	regulation of ER to Golgi vesicle-mediated transport	IMP	biological process
GO:0045165	cell fate commitment	ISS	biological process
GO:0042981	regulation of apoptotic process	ISS	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04340	Hedgehog signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881