• Gene id: 261729

Gene Summary

• Gene Symbol: STEAP2   Gene   UCSC   Ensembl
• Aliases: IPCA1, PCANAP1, PUMPCn, STAMP1, STMP
• Gene name: STEAP2 metalloreductase
• Alternate names: metalloreductase STEAP2, STEAP family member 2, metalloreductase, SixTransMembrane Protein of Prostate 1, prostate cancer-associated protein 1, protein up-regulated in metastatic prostate cancer, protein upregulated in metastatic prostate cancer, six transmembr,
• Gene location: 7q21.13 (90211739: 90243407)     Exons: 4     NC_000007.14
• Gene summary(Entrez): This gene is a member of the STEAP family and encodes a multi-pass membrane protein that localizes to the Golgi complex, the plasma membrane, and the vesicular tubular structures in the cytosol. A highly similar protein in mouse has both ferrireductase an
• OMIM: 605094

Protein Summary

• Protein general information: Q8NFT2  
  • Name: Metalloreductase STEAP2 (EC 1.16.1. ) (Prostate cancer associated protein 1) (Protein up regulated in metastatic prostate cancer) (PUMPCn) (Six transmembrane epithelial antigen of prostate 2) (SixTransMembrane protein of prostate 1)
  • Length: 490  
  • Mass: 56056
  • Tissue specificity: Expressed at high levels in prostate and at significantly lower levels in heart, brain, kidney, pancreas, and ovary. {ECO
• Sequence:

  MESISMMGSPKSLSETFLPNGINGIKDARKVTVGVIGSGDFAKSLTIRLIRCGYHVVIGSRNPKFASEFFPHVVD
  VTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNMRINQYPESNAEYLASLFPDSLIVKGFNVVS
  AWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIENLPLRLFTLWRGPVVVAISLATF
  FFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAYQLYYGTKYRRFPPWLETWLQ
  CRKQLGLLSFFFAMVHVAYSLCLPMRRSERYLFLNMAYQQVHANIENSWNEEEVWRIEMYISFGIMSLGLLSLLA
  VTSIPSVSNALNWREFSFIQSTLGYVALLISTFHVLIYGWKRAFEEEYYRFYTPPNFVLALVLPSIVILGKIILF
  LPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM

• Structural information:
  • Protein Domains: (259..40-)
    (/note="Ferric-oxidoreductase")
  • Interpro: IPR013130  IPR036291  IPR028939  
  • STRING: ENSP00000378119
• Other Databases: GeneCards:  STEAP2  Malacards:  STEAP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005768	endosome	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0008823	cupric reductase activity	IEA	molecular function
GO:0015677	copper ion import	IEA	biological process
GO:0052851	ferric-chelate reductase (NADPH) activity	IEA	molecular function
GO:0010008	endosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0009725	response to hormone	IDA	biological process
GO:0006897	endocytosis	IDA	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0045055	regulated exocytosis	IDA	biological process
GO:0030173	integral component of Golgi membrane	IDA	cellular component
GO:0030140	trans-Golgi network transport vesicle	IDA	cellular component
GO:0006893	Golgi to plasma membrane transport	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0005768	endosome	IBA	cellular component
GO:0052851	ferric-chelate reductase (NADPH) activity	IBA	molecular function
GO:0015677	copper ion import	IBA	biological process
GO:0008823	cupric reductase activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04978	Mineral absorption

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)