• Gene id: 261726

Gene Summary

• Gene Symbol: TIPRL   Gene   UCSC   Ensembl
• Aliases: TIP, TIP41, TIPRL1
• Gene name: TOR signaling pathway regulator
• Alternate names: TIP41-like protein, TIP41, TOR signaling pathway regulator-like, putative MAPK-activating protein PM10, type 2A-interacting protein,
• Gene location: 1q24.2 (168178961: 168202108)     Exons: 3     NC_000001.11
• Gene summary(Entrez): TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A) (see PPP2CA; MIM 176915), PP4 (see PPP4C; MIM 602035), and PP6 (see PPP6C; MIM 612725) (McConnell et al., 2007 [PubMed 17384681]).[supplied by OMIM, Nov 2010]
• OMIM: 611807

Protein Summary

• Protein general information: O75663  
  • Name: TIP41 like protein (Putative MAPK activating protein PM10) (Type 2A interacting protein) (TIP)
  • Length: 272  
  • Mass: 31444
• Sequence:

  MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNATDALRC
  VNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEKLKAREQIKFF
  EEVLLFEDELHDHGVSSLSVKIRVMPSSFFLLLRFFLRIDGVLIRMNDTRLYHEADKTYMLREYTSRESKISSLM
  HVPPSLFTEPNEISQYLPIKEAVCEKLIFPERIDPNPADSQKSTQVE

• Structural information:
  • Interpro: IPR007303  
  • PDB: 5D9G
  • PDBsum: 5D9G
  • STRING: ENSP00000356807
• Other Databases: GeneCards:  TIPRL  Malacards:  TIPRL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IBA	biological process
GO:0031929	TOR signaling	IBA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000077	DNA damage checkpoint	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)