• Gene id: 26168

Gene Summary

• Gene Symbol: SENP3   Gene   UCSC   Ensembl
• Aliases: SMT3IP1, SSP3, Ulp1
• Gene name: SUMO specific peptidase 3
• Alternate names: sentrin-specific protease 3, SUMO-1-specific protease 3, SUMO1/sentrin/SMT3 specific peptidase 3, sentrin/SUMO-specific protease 3,
• Gene location: 17p13.1 (7561918: 7571968)     Exons: 29     NC_000017.11
• Gene summary(Entrez): The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP3, are responsible for the initial pr
• OMIM: 612844

Protein Summary

• Protein general information: Q9H4L4  
  • Name: Sentrin specific protease 3 (EC 3.4.22. ) (SUMO 1 specific protease 3) (Sentrin/SUMO specific protease SENP3)
  • Length: 574  
  • Mass: 65010
• Sequence:

  MKETIQGTGSWGPEPPGPGIPPAYSSPRRERLRWPPPPKPRLKSGGGFGPDPGSGTTVPARRLPVPRPSFDASAS
  EEEEEEEEEEDEDEEEEVAAWRLPPRWSQLGTSQRPRPSRPTHRKTCSQRRRRAMRAFRMLLYSKSTSLTFHWKL
  WGRHRGRRRGLAHPKNHLSPQQGGATPQVPSPCCRFDSPRGPPPPRLGLLGALMAEDGVRGSPPVPSGPPMEEDG
  LRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHVAQELFQGSDLGMAEEAERPG
  EKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAM
  VRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFNSFFYDKLRTKGYDGVKRWTKNVDI
  FNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVAR
  QNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV

• Structural information:
  • Interpro: IPR038765  IPR003653  IPR037945  
  • Prosite: PS50600
  • DIP: 47511
  • STRING: ENSP00000314029
• Other Databases: GeneCards:  SENP3  Malacards:  SENP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016926	protein desumoylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0071339	MLL1 complex	IDA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0016926	protein desumoylation	IEA	biological process
GO:0071339	MLL1 complex	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)