• Gene id: 2615

Gene Summary

• Gene Symbol: LRRC32   Gene   UCSC   Ensembl
• Aliases: D11S833E, GARP
• Gene name: leucine rich repeat containing 32
• Alternate names: transforming growth factor beta activator LRRC32, garpin, glycoprotein A repetitions predominant, leucine-rich repeat-containing protein 32,
• Gene location: 11q13.5 (76670746: 76657523)     Exons: 16     NC_000011.10
• Gene summary(Entrez): This gene encodes a type I membrane protein which contains 20 leucine-rich repeats. Alterations in the chromosomal region 11q13-11q14 are involved in several pathologies. [provided by RefSeq, Jul 2008]
• OMIM: 137207

Protein Summary

• Protein general information: Q14392  
  • Name: Transforming growth factor beta activator LRRC32 (Garpin) (Glycoprotein A repetitions predominant) (GARP) (Leucine rich repeat containing protein 32)
  • Length: 662  
  • Mass: 71979
  • Tissue specificity: Preferentially expressed in regulatory T-cells (Tregs). {ECO
• Sequence:

  MRPQILLLLALLTLGLAAQHQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLGFYTAL
  RHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGLLERLLGEAPS
  LHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNLSRNSLTCISDFSLQQLRVLDL
  SCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSAL
  PLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRLGSLPCLMLLDLSHNAL
  ETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGNRVSPCGGPDEPGPSGCVAFSGITSLRSLSL
  VDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENR
  LSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLIC
  RFSSQEEVSLSHVRPEDCEKGGLKNINLIIILTFILVSAILLTTLAACCCVRRQKFNQQYKA

• Structural information:
  • Protein Domains: (21..4-)
    (/note="LRRNT-)
    (/evidence="ECO:0000255-)
    (571..62-)
    (/note="LRRCT-)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR001611  IPR003591  IPR032675  IPR000372  
  • Prosite: PS51450
  • PDB: 6GFF
  • PDBsum: 6GFF
  • DIP: 48932
  • STRING: ENSP00000384126
• Other Databases: GeneCards:  LRRC32  Malacards:  LRRC32

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031012	extracellular matrix	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0050431	transforming growth factor beta binding	IDA	molecular function
GO:1901388	regulation of transforming growth factor beta activation	IDA	biological process
GO:1901388	regulation of transforming growth factor beta activation	IDA	biological process
GO:1901388	regulation of transforming growth factor beta activation	IDA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0050431	transforming growth factor beta binding	IPI	molecular function
GO:0050431	transforming growth factor beta binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0062009	secondary palate development	ISS	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0019838	growth factor binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0046007	negative regulation of activated T cell proliferation	IEA	biological process
GO:0050431	transforming growth factor beta binding	IEA	molecular function
GO:0050710	negative regulation of cytokine secretion	IEA	biological process
GO:0062009	secondary palate development	IEA	biological process
GO:1901398	regulation of transforming growth factor beta3 activation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq