• Gene id: 26135

Gene Summary

• Gene Symbol: SERBP1   Gene   UCSC   Ensembl
• Aliases: CGI-55, CHD3IP, HABP4L, PAI-RBP1, PAIRBP1
• Gene name: SERPINE1 mRNA binding protein 1
• Alternate names: plasminogen activator inhibitor 1 RNA-binding protein, PAI-1 mRNA binding protein, PAI1 RNA-binding protein 1, chromodomain helicase DNA binding protein 3 interacting protein,
• Gene location: 1p31.3 (55166721: 55158660)     Exons: 12     NC_000019.10
• OMIM: 607378

Protein Summary

• Protein general information: Q8NC51  
  • Name: Plasminogen activator inhibitor 1 RNA binding protein (PAI1 RNA binding protein 1) (PAI RBP1) (SERPINE1 mRNA binding protein 1)
  • Length: 408  
  • Mass: 44965
  • Tissue specificity: Expressed at high level in the heart, skeletal muscle and kidney, and at low levels in placenta, liver and brain. {ECO
• Sequence:

  MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQLRKESQ
  KDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEKPLEEKGEGGE
  FSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWG
  TVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWKAIQNKD
  RAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLEINFGDLGRPGRGGRGGRGG
  RGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA

• Structural information:
  • Interpro: IPR039764  IPR006861  IPR032381  IPR027205  
  • PDB: 4V6X
  • PDBsum: 4V6X
  • DIP: 33819
  • STRING: ENSP00000360034
• Other Databases: GeneCards:  SERBP1  Malacards:  SERBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0043488	regulation of mRNA stability	NAS	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0032183	SUMO binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0030578	PML body organization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881