• Gene id: 26118

Gene Summary

• Gene Symbol: WSB1   Gene   UCSC   Ensembl
• Aliases: SWIP1, WSB-1
• Gene name: WD repeat and SOCS box containing 1
• Alternate names: WD repeat and SOCS box-containing protein 1, SOCS box-containing WD protein SWiP-1,
• Gene location: 17q11.1 (27294079: 27315925)     Exons: 10     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcri
• OMIM: 610091

Protein Summary

• Protein general information: Q9Y6I7  
  • Name: WD repeat and SOCS box containing protein 1 (WSB 1) (SOCS box containing WD protein SWiP 1)
  • Length: 421  
  • Mass: 47432
• Sequence:

  MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNFLLHGT
  KNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNG
  RIKIWDVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYSCAFSPD
  SSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVYIWDPHNGDILMEFGHLFPP
  PTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAPLSNGLCCAFSTDGSVLAAGTHDGSV
  YFWATPRQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYRI

• Structural information:
  • Protein Domains: (372..42-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR020472  IPR001496  IPR036036  IPR015943  IPR001680   IPR019775  IPR017986  IPR036322  
  • Prosite: PS50225 PS00678 PS50082 PS50294
  • STRING: ENSP00000262394
• Other Databases: GeneCards:  WSB1  Malacards:  WSB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881