• Gene id: 26108

Gene Summary

• Gene Symbol: PYGO1   Gene   UCSC   Ensembl
• Gene name: pygopus family PHD finger 1
• Alternate names: pygopus homolog 1, pygopus-like protein 1,
• Gene location: 15q21.3 (55588970: 55538883)     Exons: 4     NC_000015.10
• OMIM: 606902

Protein Summary

• Protein general information: Q9Y3Y4  
  • Name: Pygopus homolog 1
  • Length: 419  
  • Mass: 45116
• Sequence:

  MPAENSPAPAYKVSSHGGDSGLDGLGGPGVQLGSPDKKKRKANTQGPSFPPLSEYAPPPNPNSDHLVAANPFDDN
  YNTISYKPLPSSNPYLGPGYPGFGGYSTFRMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGFNRPHAFNFGP
  HDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDLASNFVPGNNSNFTSPLESNHSFIPP
  PNTFGQAKAPPPKQDFTQGATKNTNQNSSAHPPHLNMDDTVNQSNIELKNVNRNNAVNQENSRSSSTEATNNNPA
  NGTQNKPRQPRGAADACTTEKSNKSSLHPNRHGHSSSDPVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMT
  ETAYGLLTAEASAVWGCDTCMADKDVQLMRTRETFGPSAVGSDA

• Structural information:
  • Interpro: IPR019786  IPR011011  IPR001965  IPR019787  IPR013083  
  • Prosite: PS01359 PS50016
  • PDB: 2VP7 2VPB 2VPD 2VPE 2VPG
  • PDBsum: 2VP7 2VPB 2VPD 2VPE 2VPG
  • STRING: ENSP00000302327
• Other Databases: GeneCards:  PYGO1  Malacards:  PYGO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001822	kidney development	IBA	biological process
GO:0007289	spermatid nucleus differentiation	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0035064	methylated histone binding	IDA	molecular function
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0034504	protein localization to nucleus	IEA	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0001822	kidney development	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0048856	anatomical structure development	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0007289	spermatid nucleus differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881