• Gene id: 26100

Gene Summary

• Gene Symbol: WIPI2   Gene   UCSC   Ensembl
• Aliases: ATG18B, Atg21, CGI-50, IDDSSA, WIPI-2
• Gene name: WD repeat domain, phosphoinositide interacting 2
• Alternate names: WD repeat domain phosphoinositide-interacting protein 2, WD40 repeat protein interacting with phosphoinositides 2, WIPI49-like protein 2,
• Gene location: 7p22.1 (5190232: 5233854)     Exons: 37     NC_000007.14
• Gene summary(Entrez): WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI su
• OMIM: 609225

Protein Summary

• Protein general information: Q9Y4P8  
  • Name: WD repeat domain phosphoinositide interacting protein 2 (WIPI 2) (WIPI49 like protein 2)
  • Length: 454  
  • Mass: 49408
  • Tissue specificity: Ubiquitously expressed (at protein level). Highly expressed in heart, skeletal muscle and pancreas. Expression is down-regulated in pancreatic and in kidney tumors. {ECO
• Sequence:

  MNLASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSLAVGSKSGYKFFSLSSVDKLEQIYECTDTED
  VCIVERLFSSSLVAIVSLKAPRKLKVCHFKKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIHNIRDMKVLHT
  IRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASEKGT
  VIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETVKEKPPEEPTTWTGYFGKVLM
  ASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQKIPRLLVGAADGYLYMYNLDPQEGGECALMKQHRL
  DGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMI
  LRTD

• Structural information:
  • Interpro: IPR015943  IPR001680  IPR036322  IPR032911  
  • STRING: ENSP00000288828
• Other Databases: GeneCards:  WIPI2  Malacards:  WIPI2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IDA	colocalizes with
GO:0005829	cytosol	IBA	cellular component
GO:0019898	extrinsic component of membrane	IBA	cellular component
GO:0034497	protein localization to phagophore assembly site	IBA	biological process
GO:0080025	phosphatidylinositol-3,5-bisphosphate binding	IBA	molecular function
GO:0000045	autophagosome assembly	IBA	biological process
GO:0000422	autophagy of mitochondrion	IBA	biological process
GO:0006497	protein lipidation	IBA	biological process
GO:0032266	phosphatidylinositol-3-phosphate binding	IBA	molecular function
GO:0034045	phagophore assembly site membrane	IBA	cellular component
GO:0044804	autophagy of nucleus	IBA	biological process
GO:0080025	phosphatidylinositol-3,5-bisphosphate binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0034045	phagophore assembly site membrane	IDA	cellular component
GO:0032266	phosphatidylinositol-3-phosphate binding	IDA	molecular function
GO:0005776	autophagosome	IDA	NOT|colocalizes with
GO:0000407	phagophore assembly site	IDA	cellular component
GO:0080025	phosphatidylinositol-3,5-bisphosphate binding	IDA	molecular function
GO:0009267	cellular response to starvation	IDA	biological process
GO:0032266	phosphatidylinositol-3-phosphate binding	IDA	molecular function
GO:0034497	protein localization to phagophore assembly site	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0097352	autophagosome maturation	IMP	NOT|biological process
GO:0000045	autophagosome assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000045	autophagosome assembly	IMP	biological process
GO:0000407	phagophore assembly site	IEA	cellular component
GO:0080025	phosphatidylinositol-3,5-bisphosphate binding	IEA	molecular function
GO:0000045	autophagosome assembly	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0032266	phosphatidylinositol-3-phosphate binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0000407	phagophore assembly site	IDA	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034497	protein localization to phagophore assembly site	IEA	biological process
GO:0000407	phagophore assembly site	IEA	cellular component
GO:0098792	xenophagy	IEA	biological process
GO:0061739	protein lipidation involved in autophagosome assembly	IEA	biological process
GO:0032266	phosphatidylinositol-3-phosphate binding	IEA	molecular function
GO:0034045	phagophore assembly site membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05131	Shigellosis
hsa05017	Spinocerebellar ataxia
hsa04140	Autophagy - animal
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R