• Gene id: 26097

Gene Summary

• Gene Symbol: CHTOP   Gene   UCSC   Ensembl
• Aliases: C10orf77, C1orf77, FL-SRAG, FOP, SRAG, SRAG-3, SRAG-5, pp7704
• Gene name: chromatin target of PRMT1
• Alternate names: chromatin target of PRMT1 protein, friend of PRMT1 protein, small protein rich in arginine and glycine,
• Gene location: 1q21.3 (153633981: 153646305)     Exons: 17     NC_000001.11
• Gene summary(Entrez): This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent
• OMIM: 614206

Protein Summary

• Protein general information: Q9Y3Y2  
  • Name: Chromatin target of PRMT1 protein (Friend of PRMT1 protein) (Small arginine and glycine rich protein) (SRAG)
  • Length: 248  
  • Mass: 26397
  • Tissue specificity: Expressed in an erythroid progenitor cell line derived from peripheral blood. Expressed in glioblastoma cells (PubMed
• Sequence:

  MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQSL
  KQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMG
  LRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMS
  KTKGHLDAELDAYMAQTDPETND

• Structural information:
  • Interpro: IPR025715  
  • STRING: ENSP00000357679
• Other Databases: GeneCards:  CHTOP  Malacards:  CHTOP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051096	positive regulation of helicase activity	IDA	biological process
GO:0032781	positive regulation of ATPase activity	IDA	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0006406	mRNA export from nucleus	IDA	biological process
GO:0000346	transcription export complex	IDA	cellular component
GO:0008327	methyl-CpG binding	IDA	molecular function
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0031062	positive regulation of histone methylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006405	RNA export from nucleus	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)