• Gene id: 26095

Gene Summary

• Gene Symbol: PTPN20   Gene   UCSC   Ensembl
• Aliases: CT126, PTPN20A, PTPN20B, bA142I17.1, bA42B19.1
• Gene name: protein tyrosine phosphatase non-receptor type 20
• Alternate names: tyrosine-protein phosphatase non-receptor type 20, protein tyrosine phosphatase, non-receptor type 20A, protein tyrosine phosphatase, non-receptor type 20B,
• Gene location: 10q11.22 (46911371: 47003828)     Exons: 17     NC_000010.11
• Gene summary(Entrez): The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes. The encoded protein appears to be targeted to sites
• OMIM: 610630610631

Protein Summary

• Protein general information: Q4JDL3  
  • Name: Tyrosine protein phosphatase non receptor type 20 (hPTPN20) (EC 3.1.3.48)
  • Length: 420  
  • Mass: 48423
  • Tissue specificity: Present in many cell lines (at protein level). Widely expressed. {ECO
• Sequence:

  MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRNFPHNDYEDVFEEPSE
  SGSDPSMWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKIL
  EEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGEEYFY
  IATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMF
  QVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVK
  NCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD

• Structural information:
  • Protein Domains: (159..41-)
    (/note="Tyrosine-protein-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00160"-)
  • Interpro: IPR029021  IPR000242  IPR016130  IPR003595  IPR000387  
  • Prosite: PS00383 PS50056 PS50055
  • STRING: ENSP00000363459
• Other Databases: GeneCards:  PTPN20  Malacards:  PTPN20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0071345	cellular response to cytokine stimulus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray