• Gene id: 26094

Gene Summary

• Gene Symbol: DCAF4   Gene   UCSC   Ensembl
• Aliases: WDR21, WDR21A
• Gene name: DDB1 and CUL4 associated factor 4
• Alternate names: DDB1- and CUL4-associated factor 4, WD repeat domain 21A, WD repeat-containing protein 21A,
• Gene location: 14q24.2 (72926336: 72962097)     Exons: 18     NC_000014.9
• Gene summary(Entrez): This gene encodes a WD repeat-containing protein that interacts with the Cul4-Ddb1 E3 ligase macromolecular complex. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2009]
• OMIM: 616372

Protein Summary

• Protein general information: Q8WV16  
  • Name: DDB1 and CUL4 associated factor 4 (WD repeat containing protein 21A)
  • Length: 495  
  • Mass: 55694
• Sequence:

  MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGTSSVPELPGFYFDPEK
  KRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIARMGFNASSMLRKSQLGFLNVTNYCHLAHELR
  LSCMERKKVQIRSMDPSALASDRFNLILADTNSDRLFTVNDVKVGGSKYGIINLQSLKTPTLKVFMHENLYFTNR
  KVNSVCWASLNHLDSHILLCLMGLAETPGCATLLPASLFVNSHPGIDRPGMLCSFRIPGAWSCAWSLNIQANNCF
  STGLSRRVLLTNVVTGHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKATRLFHDSAVTS
  VRILQDEQYLMASDMAGKIKLWDLRTTKCVRQYEGHVNEYAYLPLHVHEEEGILVAVGQDCYTRIWSLHDARLLR
  TIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS

• Structural information:
  • Interpro: IPR015943  IPR001680  IPR017986  IPR036322  
  • Prosite: PS50082 PS50294
  • PDB: 3I8C
  • PDBsum: 3I8C
  • DIP: 48761
  • STRING: ENSP00000351147
• Other Databases: GeneCards:  DCAF4  Malacards:  DCAF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881