• Gene id: 26088

Gene Summary

• Gene Symbol: GGA1   Gene   UCSC   Ensembl
• Gene name: golgi associated, gamma adaptin ear containing, ARF binding protein 1
• Alternate names: ADP-ribosylation factor-binding protein GGA1, ADP-ribosylation factor binding protein 1, gamma-adaptin related protein 1, golgi-localized, gamma ear-containing, ARF-binding protein 1,
• Gene location: 22q13.1 (37608473: 37633563)     Exons: 20     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) protein family. Members of this family are ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysoso

Protein Summary

• Protein general information: Q9UJY5  
  • Name: ADP ribosylation factor binding protein GGA1 (Gamma adaptin related protein 1) (Golgi localized, gamma ear containing, ARF binding protein 1)
  • Length: 639  
  • Mass: 70384
  • Tissue specificity: Ubiquitously expressed.
• Sequence:

  MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMK
  SCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKSDPK
  LPDDTTFPLPPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNV
  KLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRG
  EEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTYPAMPTRPGEQASPEQPSASVSLLDDELMSLGLSDPTPPSGP
  SLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPT
  PRLTLRDLQNKSSSCSSPSSSATSLLHTVSPEPPRPPQQPVPTELSLASITVPLESIKPSNILPVTVYDQHGFRI
  LFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLAN
  PQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL

• Structural information:
  • Protein Domains: (17..14-)
    (/note="VHS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00218-)
    (171..29-)
    (/note="GAT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00373-)
    (510..63-)
    (/note="GAE-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00093"-)
  • Interpro: IPR008152  IPR013041  IPR008942  IPR008153  IPR004152   IPR038425  IPR041198  IPR002014  
  • Prosite: PS50180 PS50909 PS50179
  • PDB: 1J2J 1JWF 1JWG 1NA8 1NAF 1NWM 1O3X 1OM9 1OXZ 1PY1 1UJJ 1UJK 1X79 2DWX 2DWY 3G2S 3G2T 3G2U 3G2V 3G2W
  • PDBsum: 1J2J 1JWF 1JWG 1NA8 1NAF 1NWM 1O3X 1OM9 1OXZ 1PY1 1UJJ 1UJK 1X79 2DWX 2DWY 3G2S 3G2T 3G2U 3G2V 3G2W
  • STRING: ENSP00000341344
• Other Databases: GeneCards:  GGA1  Malacards:  GGA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034394	protein localization to cell surface	IDA	biological process
GO:0043001	Golgi to plasma membrane protein transport	IDA	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IDA	biological process
GO:0006886	intracellular protein transport	IDA	biological process
GO:0008104	protein localization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0031901	early endosome membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903441	protein localization to ciliary membrane	IEA	biological process
GO:1901998	toxin transport	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IEA	biological process
GO:0006893	Golgi to plasma membrane transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IMP	cellular component
GO:0032991	protein-containing complex	IMP	cellular component
GO:0032991	protein-containing complex	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030306	ADP-ribosylation factor binding	IPI	molecular function
GO:0030306	ADP-ribosylation factor binding	IPI	molecular function
GO:0003674	molecular_function	ND	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0006886	intracellular protein transport	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04142	Lysosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray