• Gene id: 26086

Gene Summary

• Gene Symbol: GPSM1   Gene   UCSC   Ensembl
• Aliases: AGS3
• Gene name: G protein signaling modulator 1
• Alternate names: G-protein-signaling modulator 1, G-protein signalling modulator 1 (AGS3-like, C. elegans), activator of G-protein signaling 3,
• Gene location: 9q34.3 (136327538: 136359604)     Exons: 18     NC_000009.12
• Gene summary(Entrez): G-protein signaling modulators (GPSMs) play diverse functional roles through their interaction with G-protein subunits. This gene encodes a receptor-independent activator of G protein signaling, which is one of several factors that influence the basal act
• OMIM: 609491

Protein Summary

• Protein general information: Q86YR5  
  • Name: G protein signaling modulator 1 (Activator of G protein signaling 3)
  • Length: 675  
  • Mass: 74510
  • Tissue specificity: Expressed in intestinal cells. {ECO
• Sequence:

  MAGPAPPVADELPGPAARRLYSRMEASCLELALEGERLCKAGDFKTGVAFFEAAVQVGTEDLKTLSAIYSQLGNA
  YFYLKEHGRALEYHKHDLLLARTIGDRMGEAKASGNLGNTLKVLGRFDEAAVCCQRHLSIAQEQGDKVGEARALY
  NIGNVYHAKGKQLSWNAANATQDPGHLPPDVRETLCKASEFYERNLSLVKELGDRAAQGRAYGNLGNTHYLLGNF
  TEATTFHKERLAIAKEFGDKAAERRAYSNLGNAHVFLGRFDVAAEYYKKTLQLSRQLRDQAVEAQACYSLGNTYT
  LLQDYERAAEYHLRHLLIAQELADRVGEGRACWSLGNAYVSMGRPAQALTFAKKHLQISQEIGDRHGELTARMNV
  AQLQLVLGRLTSPAASEKPDLAGYEAQGARPKRTQRLSAETWDLLRLPLEREQNGDSHHSGDWRGPSRDSLPLPV
  RSRKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSSDEECFFDLLTKFQSSRMDDQRCPLDDGQAGAA
  EATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFF
  NMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQGAGGPPEPQQQCQPGAS

• Structural information:
  • Protein Domains: (495..51-)
    (/note="GoLoco-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00097-)
    (548..57-)
    (/note="GoLoco-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00097-)
    (596..61-)
    (/note="GoLoco-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00-)
  • Interpro: IPR003109  IPR013026  IPR011990  IPR019734  
  • Prosite: PS50877 PS50005 PS50293
  • STRING: ENSP00000392828
• Other Databases: GeneCards:  GPSM1  Malacards:  GPSM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030695	GTPase regulator activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005092	GDP-dissociation inhibitor activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005938	cell cortex	IDA	colocalizes with
GO:0000139	Golgi membrane	IDA	colocalizes with
GO:0032991	protein-containing complex	IDA	cellular component
GO:1905098	negative regulation of guanyl-nucleotide exchange factor activity	IDA	biological process
GO:0034260	negative regulation of GTPase activity	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	colocalizes with
GO:0032991	protein-containing complex	IDA	cellular component
GO:0016239	positive regulation of macroautophagy	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05030	Cocaine addiction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq