• Gene id: 26085

Gene Summary

• Gene Symbol: KLK13   Gene   UCSC   Ensembl
• Aliases: KLK-L4, KLKL4
• Gene name: kallikrein related peptidase 13
• Alternate names: kallikrein-13, kallikrein-like gene 4, kallikrein-like protein 4,
• Gene location: 19q13.41 (51065105: 51055625)     Exons: 7     NC_000019.10
• Gene summary(Entrez): Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one
• OMIM: 605505

Protein Summary

• Protein general information: Q9UKR3  
  • Name: Kallikrein 13 (EC 3.4.21. ) (Kallikrein like protein 4) (KLK L4)
  • Length: 277  
  • Mass: 30570
  • Tissue specificity: Expressed in prostate, breast, testis and salivary gland.
• Sequence:

  MWPLALVIASLTLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLVQGRLLCGGVLVHPKWVLTAA
  HCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQLTGYIQTLPLSHNNR
  LTPGTTCRVSGWGTTTSPQVNYPKTLQCANIQLRSDEECRQVYPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCN
  RTLYGIVSWGDFPCGQPDRPGVYTRVSRYVLWIRETIRKYETQQQKWLKGPQ

• Structural information:
  • Protein Domains: (36..26-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • STRING: ENSP00000470555
• Other Databases: GeneCards:  KLK13  Malacards:  KLK13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030141	secretory granule	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0070268	cornification	TAS	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0016485	protein processing	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0004175	endopeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006508	proteolysis	NAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0004252	serine-type endopeptidase activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Prostate cancer	PMID:12970725
ovarian carcinoma	PMID:19707197
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R