• Gene id: 26084

Gene Summary

• Gene Symbol: ARHGEF26   Gene   UCSC   Ensembl
• Aliases: CSGEF, HMFN1864, SGEF
• Gene name: Rho guanine nucleotide exchange factor 26
• Alternate names: rho guanine nucleotide exchange factor 26, Rho guanine nucleotide exchange factor (GEF) 26, SH3 domain-containing guanine exchange factor, Src homology 3 domain-containing guanine nucleotide exchange factor, testicular tissue protein Li 171,
• Gene location: 3q25.2 (154121002: 154257826)     Exons: 17     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the Rho-guanine nucleotide exchange factor (Rho-GEF) family. These proteins regulate Rho GTPases by catalyzing the exchange of GDP for GTP. The encoded protein specifically activates RhoG and plays a role in the promotion of
• OMIM: 603011

Protein Summary

• Protein general information: Q96DR7  
  • Name: Rho guanine nucleotide exchange factor 26 (SH3 domain containing guanine exchange factor)
  • Length: 871  
  • Mass: 97346
  • Tissue specificity: Isoform 1 is broadly expressed, with highest levels in liver (at protein level). Certain mRNA species appear to be specifically expressed in prostate and liver. {ECO
• Sequence:

  MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITDFPVEDGGTLLAAQIPAQVPTASDSR
  TVHRSPLLLGAQRRAVANGGTASPEYRAASPRLRRPKSPKLPKAVPGGSPKSPANGAVTLPAPPPPPVLRPPRTP
  NAPAPCTPEEDLTGLTASPVPSPTANGLAANNDSPGSGSQSGRKAKDPERGLFPGPQKSSSEQKLPLQRLPSQEN
  ELLENPSVVLSTNSPAALKVGKQQIIPKSLASEIKISKSNNQNVEPHKRLLKVRSMVEGLGGPLGHAGEESEVDN
  DVDSPGSLRRGLRSTSYRRAVVSGFDFDSPTSSKKKNRMSQPVLKVVMEDKEKFSSLGRIKKKMLKGQGTFDGEE
  NAVLYQNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQLSAVKRKGLSQTVSQEERKRQEAIFEVISS
  EHSYLLSLEILIRMFKNSKELSDTMTKTERHHLFSNITDVCEASKKFFIELEARHQNNIFIDDISDIVEKHTAST
  FDPYVKYCTNEVYQQRTLQKLLATNPSFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDS
  PKYEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRWLVKRGELTAYVEDTVLFSRR
  TSKQQVYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDNEELNSSPGKNSSTMLYSRQSSASHLFTLTVL
  SNHANEKVEMLLGAETQSERARWITALGHSSGKPPADRTSLTQVEIVRSFTAKQPDELSLQVADVVLIYQRVSDG
  WYEGERLRDGERGWFPMECAKEITCQATIDKNVERMGRLLGLETNV

• Structural information:
  • Protein Domains: (439..62-)
    (/note="DH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00062-)
    (655..78-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (789..85-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR035797  IPR035899  IPR000219  IPR011993  IPR001849   IPR036028  IPR001452  
  • Prosite: PS50010 PS50003 PS50002
  • CDD: cd00160 cd11938
  • PDB: 6MYE
  • PDBsum: 6MYE
  • STRING: ENSP00000348828
• Other Databases: GeneCards:  ARHGEF26  Malacards:  ARHGEF26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005089	Rho guanyl-nucleotide exchange factor activity	IBA	molecular function
GO:0090630	activation of GTPase activity	IBA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0001886	endothelial cell morphogenesis	IEA	biological process
GO:0097178	ruffle assembly	IEA	biological process
GO:0001726	ruffle	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa05100	Bacterial invasion of epithelial cells

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray