• Gene id: 26065

Gene Summary

• Gene Symbol: LSM14A   Gene   UCSC   Ensembl
• Aliases: C19orf13, FAM61A, RAP55, RAP55A
• Gene name: LSM14A mRNA processing body assembly factor
• Alternate names: protein LSM14 homolog A, LSM14 homolog A, LSM14A, SCD6 homolog A, RNA-associated protein 55, RNA-associated protein 55A, alphaSNBP, family with sequence similarity 61, member A, hRAP55, hRAP55A, protein SCD6 homolog, putative alpha-synuclein-binding protein,
• Gene location: 19q13.11 (34172498: 34229514)     Exons: 11     NC_000019.10
• Gene summary(Entrez): Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length tha
• OMIM: 610677

Protein Summary

• Protein general information: Q8ND56  
  • Name: Protein LSM14 homolog A (Protein FAM61A) (Protein SCD6 homolog) (Putative alpha synuclein binding protein) (AlphaSNBP) (RNA associated protein 55A) (hRAP55) (hRAP55A)
  • Length: 463  
  • Mass: 50530
• Sequence:

  MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDL
  TVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTET
  SNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVSTRPLPS
  ASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFES
  ANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNISC
  DDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGGRGRGGGRGGTFTAPRGFRGGFRGGRGGREF
  ADFEYRKTTAFGP

• Structural information:
  • Protein Domains: (284..32-)
    (/note="DFDF-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00845"-)
  • Interpro: IPR025762  IPR019050  IPR025761  IPR025609  IPR010920   IPR025768  
  • Prosite: PS51512 PS51513 PS51536
  • CDD: cd01736
  • PDB: 6F9W
  • PDBsum: 6F9W
  • STRING: ENSP00000446271
• Other Databases: GeneCards:  LSM14A  Malacards:  LSM14A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000932	P-body	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0034063	stress granule assembly	IBA	biological process
GO:0033962	cytoplasmic mRNA processing body assembly	IBA	biological process
GO:1990124	messenger ribonucleoprotein complex	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0060340	positive regulation of type I interferon-mediated signaling pathway	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0039529	RIG-I signaling pathway	IEA	biological process
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0000932	P-body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003727	single-stranded RNA binding	IEA	molecular function
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0033962	cytoplasmic mRNA processing body assembly	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0033962	cytoplasmic mRNA processing body assembly	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray