• Gene id: 26054

Gene Summary

• Gene Symbol: SENP6   Gene   UCSC   Ensembl
• Aliases: SSP1, SUSP1
• Gene name: SUMO specific peptidase 6
• Alternate names: sentrin-specific protease 6, 2810017C20Rik, SUMO-1-specific protease 1, SUMO1/sentrin specific peptidase 6, SUMO1/sentrin specific protease 6, sentrin/SUMO-specific protease SENP6,
• Gene location: 6q14.1 (75601508: 75718280)     Exons: 27     NC_000006.12
• Gene summary(Entrez): Ubiquitin-like molecules (UBLs), such as SUMO1 (UBL1; MIM 601912), are structurally related to ubiquitin (MIM 191339) and can be ligated to target proteins in a similar manner as ubiquitin. However, covalent attachment of UBLs does not result in degradati
• OMIM: 605003

Protein Summary

• Protein general information: Q9GZR1  
  • Name: Sentrin specific protease 6 (EC 3.4.22. ) (SUMO 1 specific protease 1) (Sentrin/SUMO specific protease SENP6)
  • Length: 1112  
  • Mass: 126146
  • Tissue specificity: Highly expressed in reproductive organs, such as testis, ovary and prostate.
• Sequence:

  MAAGKSGGSAGEITFLEALARSESKRDGGFKNNWSFDHEEESEGDTDKDGTNLLSVDEDEDSETSKGKKLNRRSE
  IVANSSGEFILKTYVRRNKSESFKTLKGNPIGLNMLSNNKKLSENTQNTSLCSGTVVHGRRFHHAHAQIPVVKTA
  AQSSLDRKERKEYPPHVQKVEINPVRLSRLQGVERIMKKTEESESQVEPEIKRKVQQKRHCSTYQPTPPLSPASK
  KCLTHLEDLQRNCRQAITLNESTGPLLRTSIHQNSGGQKSQNTGLTTKKFYGNNVEKVPIDIIVNCDDSKHTYLQ
  TNGKVILPGAKIPKITNLKERKTSLSDLNDPIILSSDDDDDNDRTNRRESISPQPADSACSSPAPSTGKVEAALN
  ENTCRAERELRSIPEDSELNTVTLPRKARMKDQFGNSIINTPLKRRKVFSQEPPDALALSCQSSFDSVILNCRSI
  RVGTLFRLLIEPVIFCLDFIKIQLDEPDHDPVEIILNTSDLTKCEWCNVRKLPVVFLQAIPAVYQKLSIQLQMNK
  EDKVWNDCKGVNKLTNLEEQYIILIFQNGLDPPANMVFESIINEIGIKNNISNFFAKIPFEEANGRLVACTRTYE
  ESIKGSCGQKENKIKTVSFESKIQLRSKQEFQFFDEEEETGENHTIFIGPVEKLIVYPPPPAKGGISVTNEDLHC
  LNEGEFLNDVIIDFYLKYLVLEKLKKEDADRIHIFSSFFYKRLNQRERRNHETTNLSIQQKRHGRVKTWTRHVDI
  FEKDFIFVPLNEAAHWFLAVVCFPGLEKPKYEPNPHYHENAVIQKCSTVEDSCISSSASEMESCSQNSSAKPVIK
  KMLNKKHCIAVIDSNPGQEESDPRYKRNICSVKYSVKKINHTASENEEFNKGESTSQKVADRTKSENGLQNESLS
  STHHTDGLSKIRLNYSDESPEAGKMLEDELVDFSEDQDNQDDSSDDGFLADDNCSSEIGQWHLKPTICKQPCILL
  MDSLRGPSRSNVVKILREYLEVEWEVKKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFE
  LPMNLANWFPPPRMRTKREEIRNIILKLQEDQSKEKRKHKDTYSTEAPLGEGTEQYVNSISD

• Structural information:
  • Interpro: IPR038765  IPR003653  
  • Prosite: PS50600
  • STRING: ENSP00000402527
• Other Databases: GeneCards:  SENP6  Malacards:  SENP6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0090169	regulation of spindle assembly	IBA	biological process
GO:0090234	regulation of kinetochore assembly	IBA	biological process
GO:0016926	protein desumoylation	IBA	biological process
GO:0070139	SUMO-specific endopeptidase activity	IBA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016925	protein sumoylation	IEA	biological process
GO:0070646	protein modification by small protein removal	IDA	biological process
GO:0090234	regulation of kinetochore assembly	IMP	biological process
GO:0090169	regulation of spindle assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070139	SUMO-specific endopeptidase activity	IMP	molecular function
GO:0016926	protein desumoylation	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881